Jingzhaotoxin-III

Jingzhaotoxin-3, JZTX-III, β-theraphotoxin-Cj1a, Peptide F5-20.38, Jingzhaotoxin III
A Blocker of KV2.1 and NaV1.5 Channels
    Cat #: STJ-200
    Alternative Name Jingzhaotoxin-3, JZTX-III, β-theraphotoxin-Cj1a, Peptide F5-20.38, Jingzhaotoxin III
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3919 Da.
    Purity: >98% (HPLC)
    Effective concentration 200-500 nM.
    Sequence DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP.
    Modifications Disulfide bonds between Cys4-Cys19, Cys11-Cys24 and Cys18-Cys31.
    Structure
    • Jingzhaotoxin-III
    Molecular formula C174H241N47O46S6.
    CAS No.: 925463-91-8.
    Activity Inhibits NaV1.5 and KV2.1 channels1.
    References-Activity
    1. Xiao, Y. et al. (2004) J. Biol. Chem279, 26220.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Jingzhaotoxin-III
      Alomone Labs Jingzhaotoxin-III inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
      A. Time course of Jingzhaotoxin-III (#STJ-200) action on KV2.1 currents. Current amplitude at +40 mV was plotted as a function of time. Membrane potential was held at -80 mV and oocyte were stimulated by a 100 ms voltage ramp to +40 mV. 200 nM Jingzhaotoxin-III (applied for 160 sec, green) was perfused during the period marked by the bar, as indicated and showed 80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 200 nM Jingzhaotoxin-III (taken from experiment in A).
    References - Scientific background
    1. Xiao, Y. et al. (2004) J. Biol. Chem279, 26220.
    2. Yuan, C. et al. (2007) Biochem. Biophys. Res. Commun352, 799.
    3. Lee, S. et al. (2010) Biochemistry 49, 5134.
    Scientific background

    Jingzhaotoxin-III (JZTX–III), a peptide toxin isolated from the venom of the Chinese tarantula Chilobrachys Jingzhao, is composed of 36 amino acid residues including 6 cysteines cross-linked in a pattern of I-IV, II-V, and III-VI1.

    Electrophysiological recordings carried out in Xenopus laevis oocytes show that this toxin acts as a gating modifier of voltage-dependent K+ channels. It slows the rate of KV2.1 channel activation and increases the tail current deactivation, suggesting that toxin-bound channels can still open but are modified. JZTX- III selectively inhibits KV2.1 channels2. JZTX- III blocks KV2.1 currents with an IC50 value of 430 nM in Xenopus oocytes3. It has also been shown to block NaV1.5 with an IC50 value of 0.38 μM in rat cardiac myocytes1.

    Target NaV1.5, KV2.1 channels
    Net Peptide Content: 100%
    Last update: 24/01/2020

    Jingzhaotoxin-III (#STJ-200) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information