Free shipping starts now, no minimum, no coupons required!

Maurotoxin

K+ channel toxin α-KTx 6.2, MTX
A Potent Blocker of KCa and KV1 K+ Channels
Cat #: STM-340
Alternative Name K+ channel toxin α-KTx 6.2, MTX
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3612 Da.
    Purity: >99% (HPLC)
    Effective concentration 1-200 nM.
    Sequence VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC.
    Modifications Disulfide bonds between Cys3-Cys24, Cys9-Cys29, Cys13-Cys19 and Cys31-Cys34. Cys34 - C-terminal amidation.
    Structure
    Molecular formula C145H232N46O46S8.
    Activity Maurotoxin activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa2.2, KCa3.1), KCNA (KCNA1, KCNA2 and KCNA3) and Shaker-B K+ currents and seems to be very potent blocker of either KCa3.1 and KCNA2 channels1.
    References-Activity
    1. Kharrat, R. et al. (1997) FEBS. Lett406, 284.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Maurotoxin inhibits KV1.2 channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Maurotoxin inhibits KV1.2 channels heterologously expressed in Xenopus oocytes.
      A. Superimposed example traces of KV1.2 channel currents in response to ramp depolarization (from -80 mV to 40 mV during 100 msec) before (black) and during the application of increasing concentrations of Maurotoxin (#STM-340) (inset) for 100 sec. B. Example of time course showing fast and reversible effect of 2 nM Maurotoxin on the current amplitude (as extracted from the ramp responses at 0 mV).
    References - Scientific background
    1. Kharrat, R. et al. (1996) Eur. J. Biochem242, 491.
    2. Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865.
    3. Kharrat, R. et al. (1997) FEBS. Lett406, 284.
    4. Carlier, E. et al. (2000) J. Pept. Res55, 419.
    5. Castle, N.A. et al. (2003) Mol. Pharmacol63, 409.
    6. Visan, V. et al. (2004) Toxicon 43, 973.
    7. Visan, V. et al. (2004) Mol. Pharmacol66, 1103.
    Scientific background

    Maurotoxin (MTX) is a 34 amino acid long toxin, isolated from the venom of the scorpion Scorpio Maurus palmatus, and is classified as α-KTx6.2 scorpion toxin family, having four disulfide bridges1,2.

    MTX activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa3.1), KV1 (KV1.1, KV1.2 and KV1.3) and Shaker-B K+ currents. MTX inhibits the binding of 125I-Apamin and 125I-Kaliotoxin to rat brain synaptosomal membranes with an IC50 of 5 nM and 30 pM, respectively3. Furthermore, MTX blocks KCNA1 (KV1.1), KCNA2 (KV1.2) and KCNA3 (KV1.3) expressed in Xenopus oocyes with an IC50 of 45 nM, 0.8 nM, and 180 nM, respectively3. Maurotoxin blocks Shaker-B K+ current with an IC50 of 2 nM4. In contrast to previous reports, MTX was recently shown to have no effect on KCa1.1, KCa2.1 and KCa2.2 small conductance KCa channels up to 300 nM in physiologically relevant ionic strength buffers, but rather produces a high and specific block towards KCa3.1 (IKca1, SK4) and KCNA2 (KV1.2) with IC50 of 1 nM and 0.1 nM, respectively5. Furthermore, MTX was shown to block Gardos channel in human red blood cells and to inhibit the KCa in activated human T-lymphocytes without affecting the voltage-gated K+ current encoded by KCNA35. Moreover, MTX inhibition was shown to be pH-dependent6,7.

    In conclusion, Maurotoxin seems to be a very potent blocker of both KCa3.1 and KV1.2 channels.

    Target KCa and KV1 K+ channels
    Net Peptide Content: 100%
    Image & Title Maurotoxin
    Alomone Labs Maurotoxin causes membrane depolarization of mouse pancreatic duct cells through SK4 channel inhibition.Application of 10 nM Maurotoxin (#STM-340) to cells causes a significant depolarization of membrane potential by 4.7 ± 0.8 mV (n = 10).Adapted from Hayashi, M. et al. (2012) Am. J. Physiol. 303, C151. with permission of The American Physiological Society.
    Last update: 16/08/2020

    Maurotoxin (#STM-340) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Hayashi, M. et al. (2012) Am. J. Physiol. 303, C151.
    2. Fulton, S. et al. (2012) J. Biol. Chem. 286, 9360.
    3. Kasten, M.R. et al. (2007) J. Physiol. 584.2, 565.
    Shipping and Ordering information