Recombinant human beta-NGF protein

β-Nerve Growth Factor
Human β-Nerve Growth Factor, Recombinant, E. coli
    Cat #: N-245
  • Lyophilized Powder
  • Bioassay Tested
  • Sterile & Endotoxin Free
  • Source Recombinant, E. coli
    MW: 27 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Formulation Lyophilized from a 0.2 µm filtered solution.
    Effective concentration EC50 = 0.4 nM.
    Sequence SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
    Structure
    Activity NGF is purified in three forms: the 7S, 2.5S and β. The biologically active subunit is the β, which is a 26 kDa. dimer composed of two identical chains held together by hydrophobic interactions1. NGF has been shown to regulate neuronal survival, development function and plasticity2.
    References - Activity
    1. Bradshaw, R.A. (1978) Ann. Rev. Biochem 47, 191.

    2. Huang, E.J. and Reichardt, L.F. (2001) Annu. Rev. Neurosci24, 677.

    Storage before reconstitution Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Reconstitution Sterile water, DMEM at a concentration of at least 10 µg/ml. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage after reconstitution Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    Alomone Labs Recombinant human beta-NGF protein promotes survival of PC12 cells.
    Cells were grown in the absence of serum and collagen, and in the presence of varying concentrations of Recombinant human beta-NGF protein (#N-245). Cell survival relative to the control was measured by the XTT method, and plotted against Recombinant human beta-NGF protein concentration.
    Alomone Labs Recombinant human beta-NGF protein promotes neurite outgrowth in PC12 cells.
    Cells were grown on collagen coated 24 well plates in DMEM medium, supplemented with 6% fetal calf serum and 6% horse serum for 24 h. Recombinant human beta-NGF protein (#N-245) was added at the indicated concentrations. The culture media was changed every 2-3 days. The development of neurites over a period of 5 days was visualized by Methylene Blue staining.
    References - Scientific Background
    1. Roux, P. et al. (2002) Prog. Neurobiol67, 203.
    2. Levi-Montalcini, R. (1966) Harvey Lect. 60, 217.
    3. Farinas, I. et al. (1998) Neuron 21, 325.
    4. Levi-Montalcini, R. et al. (1996) Trends Neurosci19, 514.
    5. McDonald, N.Q. et al. (1991) Nature 354, 411.
    6. Huang, E.J. and Reichardt, L.F. (2001) Annu. Rev. Neurosci24, 677.
    7. Freund V. and Frossard, N. (1994) Prog. Brain Res146, 335.
    8. Raychaudhuri, S.P. and Raychaudhuri, S.K. (2004) Prog. Brain Res146, 433.
    9. Kawamoto, K. and Matsuda, H. (2004) Prog. Brain. Res146, 369.
    10. Teng, K.K. and Hempstead, B.L. (2004) Cell Mol. Life Sci61, 35.
    Scientific background

    The neurotrophins ("neuro" means nerve and "trophe" means nutrient) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and the PNS.1 NGF, the first member of the family to be discovered, was originally purified as a factor able to support survival of sympathetic and sensory spinal neurons in culture.2 It is synthesized and secreted by sympathetic and sensory target organs and provides trophic support to neurons as they reach their final target.3

    Neurotrophin secretion increases in the nervous system following injury. Schwann cells, fibroblasts, and activated mast cells normally synthesize NGF constitutively, however direct trauma and induction of cytokines combine to increase neurotrophin production in these cells after injury.4

    The structural hallmark of all the neurotrophins is the characteristic arrangement of the disulfide bridges known as the cysteine knot, which has been found in other growth factors such as Platelet-Dervied Growth Factor.5 There is a 95.8% homology between the rat and mouse forms, and a 85% homology between the human and mouse.

    NGF has been shown to regulate neuronal survival, development function and plasticity.6 Recently, involvement of NGF in processes not involving neuronal cells has been shown, such as asthma,7 psoriasis8 and wound healing.9 The biological effects of NGF are mediated by two receptors: TrkA, which is specific for NGF, and p75NTR, which binds all the neurotrophins.10

    Net Peptide Content: 100%
    Last update: 31/12/2018

    Recombinant human beta-NGF protein (#N-245) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use