Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Ca2+-Activated K+ Channels › Blockers

Scyllatoxin

K+ channel toxin α-KTx 5.1, Leiurotoxin I, LeTx I, ScyTx

A Potent Blocker of KCa2 (SK) K+ Channels

Cat #: STS-370
Alternative Name K+ channel toxin α-KTx 5.1, Leiurotoxin I, LeTx I, ScyTx
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3423 Da
    Purity: >98% (HPLC)
    Effective concentration 20-200 nM.
    Sequence AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH.
    Modifications Disulfide bonds between Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28. His31 - C terminal amidation.
    Structure
    Molecular formula C142H237N45O39S7.
    CAS No.: 142948-19-4
    Activity Scyllatoxin inhibits small conductance Ca2+-activated K+ channels (SK)1-3.
    References-Activity
    1. Wadsworth, J.D. et al. (1994) J. Biol. Chem. 269, 18053.
    2. Grissmer, S. et al. (1992) J. Gen. Physiol. 99, 63.
    3. Jager, H. and Grissmer, S. (1997) Cell. Physiol. Biochem. 7, 179.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Scyllatoxin inhibits rSK2 channels stably expressed in HEK293T cells.
      Alomone Labs Scyllatoxin inhibits rSK2 channels stably expressed in HEK293T cells.
      rSK2 channel currents were measured using whole cell voltage clamp in the presence of Ca2+ in the pipette solution. A voltage ramp from -120 mV to +60 mV was applied every 10 sec from a holding potential of -80 mV. A. Time course of current amplitude at 0 mV before (black) and during (green) application of 1 nM Scyllatoxin (#STS-370). B. Representative current traces at control conditions (black) and following 140 s application of 1 nM Scyllatoxin (green), taken from the experiment in A.
    • Alomone Labs Scyllatoxin inhibits KCa2.2 channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Scyllatoxin inhibits KCa2.2 channels heterologously expressed in Xenopus oocytes.
      Oocyte membrane potential was held at +5 mV (in a low Cl- solution) and currents were elicited by intraoocyte CaCl2 injection. During the period marked by a green trace (30 seconds), 100 nM of Scyllatoxin (#STS-370) was applied by perfusion.
    References - Scientific background
    1. Chicchi, G.G. et al. (1988) J. Biol. Chem. 263, 10192.
    2. Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865.
    3. Auguste, P. et al. (1992) Biochemistry 31, 648.
    4. Wadsworth, J.D. et al. (1994) J. Biol. Chem. 269, 18053.
    5. Grissmer, S. et al. (1992) J. Gen. Physiol. 99, 63.
    6. Jager, H. and Grissmer, S. (1997) Cell. Physiol. Biochem. 7, 179.
    7. Auguste, P. et al. (1990) J. Biol. Chem., 265, 4753.
    8. Goh, J.W. et al. (1992) Brain Res. 591. 165.
    9. Pedarzani, P. et al. (2000) J. Physiol. 527, 283.
    10. Strøbaek, D. et al. (2000) Br. J. Pharmacol. 129, 991.
    Scientific background

    Scyllatoxin is a 31 amino acid long toxin, originally isolated from the Leiurus quinquestriatus hebraeus scorpion venom, and is classified as α-KTx 5.1 scorpion toxin family, having three disulfide bridges1,2.

    Scyllatoxin was shown to compete with 125I-apamin binding in the brain3. Furthermore, Scyllatoxin appears to be selective for apamin-sensitive SK channels. Scyllatoxin inhibits apamin-sensitive SK channel activity in guinea-pig and rabbit hepatocytes4, SK currents in human lymphoblastoma cells5,6, and epinephrine-induced relaxation of visceral smooth muscle7.

    Scyllatoxin also inhibits the apamin-sensitive after hyperpolarization that follows action potentials in skeletal muscle7 and neurons8. The SK channel-mediated after hyperpolarising current (IAHP) of dorsal vagal neurons, presuming Kca2.3 (SK3), were blocked by Scyllatoxin (20-30 nM)9. HEK 293 cell currents stably expressing hKca2.1 (hSK1) and Kca2.2 (hSK2) were blocked by Scyllatoxin with an IC50 of 80 nM and 287 pM, respectively10.

    Target KCa2 K+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    Last update: 11/04/2021

    Scyllatoxin (#STS-370) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations

    Related Products

    Shipping and Ordering information

    Resources

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us