Wasabi Receptor Toxin

WaTx
A Cell-Penetrating Activator of TRPA1 Channel
  • New
Cat #: STW-200
Alternative Name WaTx
  • Lyophilized Powder
  • Bioassay Tested
  • Source Synthetic peptide
    MW: 3855 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder
    Effective concentration 0.5-5 µM
    Sequence ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
    Modifications Disulfide bonds between: Cys44-Cys62, Cys48-Cys58
    Structure
    • Wasabi Receptor Toxin
    Molecular formula C164H245N45O53S5
    Activity Wasabi Receptor Toxin is a cell penetrating peptide toxin activator of TRPA1 Channel1.
    References-Activity
    1. King, J.V.L. et al. (2019) Cell 178, 1362.
    Shipping and storage At room temperature.
    Solubility Soluble in DDW. Centrifuge all products before use (10000 x g 5 min).
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
    Our bioassay
    • Wasabi Receptor Toxin
      Alomone Labs Wasabi receptor toxin leads to Ca2+ signals in HEK 293 cells transfected with TRPA1.
      A. Upper, individual traces (grey) and mean trace (black) of changes in intracellular Ca2+ concentration with time (measured as a change in FURA-2AM fluorescent intensity) in HEK 293 cells transfected with human TRPA1, following application of 5 µM Wasabi receptor toxin (#STW-200) followed by 200 µM AITC. Bottom, Mean ± SEM of changes in intracellular Ca2+ in HEK 293 cells transfected with human TRPA1, following application of 5 µM Wasabi receptor toxin followed by 200 µM AITC. n = 42 cells, representative of 5 plates. B. Same as in A, but in untransfected HEK 293 cells. Ionomycin was added at the end of each experiment. n = 60 cells, representative of 3 plates.  

      Figure kindly provided by Prof. Alexander Binshtok, Dept. Medical Neurobiology, Institute for Medical Research, IMRIC, Hebrew University School of Medicine, Jerusalem.
    References - Scientific background
    1. King, J.V.L. et al. (2019) Cell 178, 1362.
    2. Bandell, M. et al. (2004) Neuron 41, 849.
    3. Bautista, D.M. et al. (2013) Annu. Rev. Physiol. 75, 181.
    Scientific background

    Wasabi receptor toxin (WaTx) is a peptide toxin originally isolated from Urodacus manicatus (Australian Black Rock scorpion) venom. The peptide toxin activates TRPA1 channel by a novel mechanism: it penetrates the cell and stabilizes the channel’s open state, thereby causing pain1.

    TRPA1 ion channel is a chemosensory receptor for a broad class of volatile environmental irritants. It is expressed in sensory neurons and activated by natural products from mustard and allium plants. This activation elicits the sinus clearing or eye stinging pain one experiences when eating wasabi or chopping an onion2.

    TRPA1 is also a sensor for endogenous inflammatory agents that directly activate this channel to produce acute and persistent pain2. TRPA1 is considered a promising therapeutic target for treating chronic pain, itch, and neurogenic inflammatory syndromes3.

    Target TRPA1 channel
    Net Peptide Content: 100%

    Check out more of our new products.

    Last update: 04/06/2020

    Wasabi Receptor Toxin (#STW-200) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Shipping and Ordering information