Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Ligand-Gated Ion Channels › Nicotinic Acetylcholine Receptors › Antagonists

α-Bungarotoxin-FITC

Long neurotoxin 1, α-Bgtx, α-BuTX

A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites

Cat #: B-100-F
Alternative Name Long neurotoxin 1, α-Bgtx, α-BuTX
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Modified natural protein isolated from Bungarus multicinctus (Many-banded krait).
    MW: ~8406 Da
    Purity: >95% (HPLC)
    Form Lyophilized powder.
    Effective concentration 1 nM - 3 μM.
    Sequence IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG.
    Modifications Disulfide bonds between Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys and Cys60-Cys65.
    Label Fluorescein Isothiocyanate (FITC). The extent of labeling is 1-2 molecules of FITC dye per molecule α-Bungarotoxin.
    Structure
    Activity α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 μM)1,2. The toxin also blocks GABA(A) receptor subtypes3.
    References-Activity
    1. Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687.
    2. Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647.
    3. McCann, C.M. et al. (2006) Proc. Natl. Acad. Sci. U.S.A. 103, 5149.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Avoid exposure to light.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). Avoid exposure to light.
    Storage of solutions Up to two weeks at 4°C or three months at -20°C. Avoid exposure to light.
    Our bioassay
    • Alomone Labs α-Bungarotoxin-FITC in whole mount staining of mice Gastrocnemius muscle.
      Alomone Labs α-Bungarotoxin-FITC in whole mount staining of mice Gastrocnemius muscle.
      Whole mount staining of mouse Gastrocnemius muscle was stained with the neuromuscular junction marker α-Bungarotoxin-FITC (#B-100-F) at 3 µg/ml in PBS.
      The image was taken using Nikon Epifluorescence microscopy at 60X magnification and is kindly provided by Dr. Eran Perlsson, Dept. of Physiology and Pharmacology, Tel-Aviv University, Tel-Aviv, Israel.
    • Alomone Labs α-Bungarotoxin-FITC inhibits α7 nAChR heterologously expressed in Xenopus oocytes.
      Alomone Labs α-Bungarotoxin-FITC inhibits α7 nAChR heterologously expressed in Xenopus oocytes.
      A. Time course of α-Bungarotoxin-FITC (#B-100-F) action on α7 nAChR currents, elicited every 50 sec by transient 2 sec applications of 100 µM ACh + 0.3 μM PNU-120596, while membrane potential was held at -80 mV. Application of 0.5 µM α-Bungarotoxin-FITC significantly inhibits the currents (green). B. Superimposed traces of α7 nAChR currents in the absence (black) and presence (green) of 0.5 µM α-Bungarotoxin-FITC (taken from the experiment in A).
    References - Scientific background
    1. Ohta, M. et al. (1987) FEBS Lett. 222, 79.
    2. Wilson, P.T. et al. (1988) Mol. Pharmacol. 34, 643.
    3. Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687.
    4. Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647.
    5. McCann, C.M. et al. (2006) Proc. Natl. Acad. Sci. U.S.A. 103, 5149.
    Scientific background

    α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1.

    α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2.

    The toxin is selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 µM)3,4.

    α-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR β3 subunit. In particular, α-Bungarotoxin blocks GABAARs that contain interfaces between adjacent β3 subunits5.

    Target α7, α1/β1/γ/δ nAChR and GABA(A) receptor subtypes
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 02/01/2022

    α-Bungarotoxin-FITC (#B-100-F) is a highly pure, natural, and biologically active conjugated peptide toxin.

    We gladly take on collaboration projects. Please Contact Us.

    See Related Products

    For research purposes only, not for human use

    Applications

    Citations

    Specifications

    Scientific Background

    Related Products

    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us