Name: α-Bungarotoxin-FITC
Brand: Alomone Labs
SKU: B-100-F

Overview

Cat #: B-100-F

Alternative Name Long neurotoxin 1, α-Bgtx, α-BuTX

Lyophilized Powder yes

Origin Modified natural protein isolated from Bungarus multicinctus (Many-banded krait).

MW: ~8406 Da

Purity: >95% (HPLC)

Form Lyophilized powder.

Effective concentration 1 nM - 3 μM.

Sequence IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG.

Modifications Disulfide bonds between Cys³-Cys²³, Cys¹⁶-Cys⁴⁴, Cys²⁹-Cys³³, Cys⁴⁸-Cys and Cys⁶⁰-Cys⁶⁵.

Label Fluorescein Isothiocyanate (FITC). The extent of labeling is 1-2 molecules of FITC dye per molecule α-Bungarotoxin.

Structure

Activity α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC₅₀ value of 1.6 nM) and α3/β4 receptors (IC₅₀ value of >3 μM)^1,2. The toxin also blocks GABA(A) receptor subtypes³.

References-Activity

Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687.
Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647.
McCann, C.M. et al. (2006) Proc. Natl. Acad. Sci. U.S.A. 103, 5149.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Avoid exposure to light.

Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). Avoid exposure to light.

Storage of solutions Up to two weeks at 4°C or three months at -20°C. Avoid exposure to light.

Our bioassay

Alomone Labs α-Bungarotoxin-FITC in whole mount staining of mice Gastrocnemius muscle.
Whole mount staining of mouse Gastrocnemius muscle was stained with the neuromuscular junction marker α-Bungarotoxin-FITC (#B-100-F) at 3 µg/ml in PBS.
The image was taken using Nikon Epifluorescence microscopy at 60X magnification and is kindly provided by Dr. Eran Perlsson, Dept. of Physiology and Pharmacology, Tel-Aviv University, Tel-Aviv, Israel.
Alomone Labs α-Bungarotoxin-FITC inhibits α7 nAChR heterologously expressed in Xenopus oocytes.
A. Time course of α-Bungarotoxin-FITC (#B-100-F) action on α7 nAChR currents, elicited every 50 sec by transient 2 sec applications of 100 µM ACh + 0.3 μM PNU-120596, while membrane potential was held at -80 mV. Application of 0.5 µM α-Bungarotoxin-FITC significantly inhibits the currents (green). B. Superimposed traces of α7 nAChR currents in the absence (black) and presence (green) of 0.5 µM α-Bungarotoxin-FITC (taken from the experiment in A).

References - Scientific background

Ohta, M. et al. (1987) FEBS Lett. 222, 79.
Wilson, P.T. et al. (1988) Mol. Pharmacol. 34, 643.
Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687.
Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647.
McCann, C.M. et al. (2006) Proc. Natl. Acad. Sci. U.S.A. 103, 5149.

Scientific background

α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus¹.

α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC₅₀ of 3.5 x 10^-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission².

The toxin is selective for α7 receptors (IC₅₀ value of 1.6 nM) and α3/β4 receptors (IC₅₀ value of >3 µM)^3,4.

α-Bungarotoxin also binds to and blocks a subset of GABA_A receptors (GABA_ARs) that contain the GABA_AR β3 subunit. In particular, α-Bungarotoxin blocks GABA_ARs that contain interfaces between adjacent β3 subunits⁵.

Target α7, α1/β1/γ/δ nAChR and GABA(A) receptor subtypes

Peptide Content: 100%

Lyophilized Powder

α-Bungarotoxin-FITC (#B-100-F) is a highly pure, natural, and biologically active conjugated peptide toxin.

We gladly take on collaboration projects. Please Contact Us.

Certificate of Analysis SDS

For research purposes only, not for human use

Last Update: 10/04/2023

Navigation

Order Summary

α-Bungarotoxin-FITC

Overview

Applications

Citations

Specifications

Scientific Background

Need Help With This Product?