Aa1 Toxin

K+ channel toxin α-KTx 15.4, AaTX1
A Novel Blocker of Shaker-B and IA K+ Channels
Cat #: RTA-400
Alternative Name K+ channel toxin α-KTx 15.4, AaTX1
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Androctonus australis (Sahara scorpion).
    Source Recombinant, E. coli
    MW: 3868 Da.
    Purity: >98% (HPLC)
    Effective concentration 100 nM - 1 µM.
    Sequence QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP.
    Modifications Disulfide bonds between Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35.
    Molecular formula C156H266N54O49S6.
    Activity Aa1 Toxin is a blocker of A-type voltage-gated transient K+ channels of cerebellar granular cells1,2.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • Alomone Labs Aa1 Toxin inhibits Shaker-B channels expressed in Xenopus oocytes.
        Left: Current responses to 100 ms depolarization to 0 mV from holding potential of -100 mV, delivered every 10 seconds before (red) and during (green) application of 1 µM Aa1 Toxin (#RTA-400). Right: Time course of amplitude inhibition.
      • Native Aa1 was originally isolated from Androctonus australis scorpion venom. Aa1 blocks Shaker B channels expressed in Xenopus oocytes with IC50=4.5 µM.1 In addition, the Aa1 toxin was shown to block the fast (A-type) K+ current in cerebellum granular cells (IC 50 =134 nM,2 or Kd = 150 nM3). In both cases the block is non-voltage-dependent and does not affect kinetic parameters of the K+ currents.
    Target KV1.3 K+ channels
    Net Peptide Content: 100%
    Last update: 03/04/2019

    Aa1 Toxin (#RTA-400) is a highly pure, recombinant, and biologically active peptide toxin.

    For research purposes only, not for human use