Cat #:
RTA-400
Alternative Name K+ channel toxin α-KTx 15.4, AaTX1
Lyophilized Powder yes
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Recombinant, E. coli
MW: 3868 Da
Purity: >98% (HPLC)
Effective concentration 100 nM - 1 µM.
Sequence QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP.
Modifications Disulfide bonds between Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35.
Molecular formula C156H266N54O49S6.
Activity Aa1 Toxin is a blocker of A-type voltage-gated transient K+ channels of cerebellar granular cells1,2.
References-Activity
- Pisciotta, M. et al. (1998) Biochem. Biophys. Res. Comm. 242, 287.
- Pisciotta, M. et al. (1998) Eur. Biophys. J. 27, 69.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Aa1 Toxin inhibits Shaker-B channels expressed in Xenopus oocytes.Left: Current responses to 100 ms depolarization to 0 mV from holding potential of -100 mV, delivered every 10 seconds before (red) and during (green) application of 1 µM Aa1 Toxin (#RTA-400). Right: Time course of amplitude inhibition.
References - Scientific background
- Pisciotta, M. et al. (1998) Biochem. Biophys. Res. Comm. 242, 287.
- Pisciotta, M. et al. (1998) Eur. Biophys. J. 27, 69.
- Pisciotta, M. et al. (2000) Biochim. Biophys. Acta. 1468, 203.
Scientific background Native Aa1 was originally isolated from Androctonus australis scorpion venom. Aa1 blocks Shaker B channels expressed in Xenopus oocytes with IC50=4.5 µM.1 In addition, the Aa1 toxin was shown to block the fast (A-type) K+ current in cerebellum granular cells (IC 50 =134 nM,2 or Kd = 150 nM3). In both cases the block is non-voltage-dependent and does not affect kinetic parameters of the K+ currents.
Target KV1.3 K+ channels
Peptide Content: 100%
Lyophilized Powder
Last update: 02/01/2022
Aa1 Toxin (#RTA-400) is a highly pure, recombinant, and biologically active peptide toxin.
For research purposes only, not for human use
Applications
Citations
Citations
Specifications
Scientific Background
Related Products
Related Products
Shipping and Ordering information
Resources
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us