Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Spinoxin

Potassium channel toxin alpha-KTx 6.13, SPX, α-KTx6.13

A Potent Blocker of KV1.2 and KV1.3 Channels

Cat #: STS-500
Alternative Name Potassium channel toxin alpha-KTx 6.13, SPX, α-KTx6.13
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3701.2 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 2-100 nM.
    Sequence IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC.
    Modifications Disulfide bonds between Cys3-Cys24, Cys9-Cys29, Cys13-Cys31 and Cys19-Cys34. Cys34 – C-terminal amidation.
    Structure
    Molecular formula C147H236N48O46S9.
    Activity Spinoxin is a potent blocker of KV1.2 and KV1.3 channels1.
    References-Activity
    1. Peigneur, S. et al. (2016) Biochemistry. 55, 2927.
    Accession number P84094.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Spinoxin blocks KV1.2 channels expressed in Xenopus oocytes.
      Alomone Labs Spinoxin blocks KV1.2 channels expressed in Xenopus oocytes.
      A. Representative time course of Spinoxin (#STS-500) inhibition of KV1.2 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +50 mV every 10 sec, and reversibly inhibited by application of 0.1 nM and 1 nM Spinoxin (indicated by bars). B. Superimposed traces of KV1.2 current after the application of control, 0.1 nM and 1 nM Spinoxin (as indicated). Taken from the recording in A.
    References - Scientific background
    1. Peigneur, S. et al. (2016) Biochemistry. 55, 2927.
    2. Yamaguchi, Y. et al. (2016) Toxicon 122, 31.
    Scientific background

    Spinoxin (SPX, α-KTx6.13) is a 34-residue peptide toxin originally isolated from the scorpion Heterometrus spinifer venom. Spinoxin is a potent KV1.3 channel blocker displaying IC50 values of 63 nM. It also has high affinity towards KV1.2 channels1,2.

    K+ ion channels play an important role in the modulation of Ca2+ signaling by controlling the membrane potential. These channels are considered to be very important targets in the diagnostics and therapy in several autoimmune disorders and cancers1.

    Target KV1.2, KV1.3 channels
    Net Peptide Content: 100%
    Lyophilized Powder
    Last update: 02/03/2021

    Spinoxin (#STS-500) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources

    KV1.3 Channels

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us