Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

AmmTx3 Toxin

Potassium channel toxin α-KTx 15.3

A Blocker of A-Type K+ Channels

Back to product page SDS

Overview

Cat #: STA-305
Alternative Name Potassium channel toxin α-KTx 15.3
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3822 Da
Purity: >98% (HPLC)
Effective concentration 1-5 µM.
Sequence ZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP.
Modifications Disulfide bonds between Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35. Z= Pyrrolidone carboxylic acid.
Structure
Molecular formula C158H262N50O48S6.
Activity AamTx3 Toxin is a blocker of A-type voltage-gated K+ channels as well as ERG1, KV11.1 and KCNH2 K+ channels1,2.
References-Activity
  1. Maffie, J.K. et al. (2013) J. Physiol. 591, 2419.
  2. Vacher, H. et al. (2002) Eur. J. Biochem. 269, 6037.
Accession number P60208.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs AmmTx3 Toxin inhibits KV4.2 currents heterologously expressed in Xenopus oocytes.
    Alomone Labs AmmTx3 Toxin inhibits KV4.2 currents heterologously expressed in Xenopus oocytes.
    A. Time course of AmmTx3 Toxin (#STA-305) blocking action on KV4.2 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at –90 mV and cells were stimulated by a 120 ms voltage step to 0 mV. 5 µM AmmTx3 Toxin were perfused as indicated by the bar (green) during 280 sec application. B. Superimposed examples of KV4.2 channel current in the absence (control) and presence (green) of 5 µM AmmTx3 Toxin (taken from the experiment in A).
Scientific background

AmmTX3 is a member of the α-KTX15 family of scorpion toxins which includes 6 homologous peptides found in four species of scorpion venoms -Aa1, AaTX1, AaTX2, AmmTX3, BmTX3 and Discrepin. AmmTx3 shares homology of 94% with Aa1 and 91% with BmTx3 and is originally isolated from the venom of the scorpion Androctonus mauretanicus. This toxin selectively blocks A-type K+ channels in cerebellum granular cells or cultured striatum neurons from rat brain.

AmmTx3 is a pore blocker of KV4.2 and KV4.3 subunits and requires for its action the expression of the KV4 associated protein dipeptidyl peptidase-like proteins 6 (DPP6). AmmTX3 structure consists of a single chain of 37 amino acid residues cross-linked by three disulphide bridges1,2.

Target KV4 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 20/04/2023

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Guangxitoxin-1E (#STG-200)
  2. Heteropodatoxin-2 (#STH-340)
  3. Jingzhaotoxin-V (#STJ-050)
  4. Anti-KV4.2 Antibody (#APC-023)
  5. Guinea pig Anti-KV4.2 Antibody (#APC-023-GP (formerly AGP-038))
  6. Shaker (KV)-Related Channel Antibody Explorer Kit (#AK-220)
  7. Shaker (KV)-Related Channel Blocker Explorer Kit (#EK-108)
  8. KV4 Channel Blocker Explorer Kit (#EK-130)

Resources

  • KV4 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • KV4 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

© 2023 Alomone Labs. All Rights Reserved.

Terms of Service Privacy Policy
Scroll to top

Bulk / Customized order