Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Heteropodatoxin-2

κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2

A Potent Blocker of KV4 K+ Channels

Cat #: STH-340
Alternative Name κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3413 Da
    Purity: >98% (HPLC)
    Effective concentration 100-500 nM.
    Sequence DDCGKLFSGCDTNADCCEGYVCRLWCKLDW.
    Modifications Disulfide bonds between Cys3-Cys17, Cys10-Cys22, and Cys16-Cys26. Trp30 - C-terminal amidation.
    Structure
    Molecular formula C144H213N39O46S6.
    Activity Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Lacks affinity for KV1.4, KV2.1 and KV3.41,2. Also blocks Ca2+ channels1.
    References-Activity
    1. Sanguinetti, M.C. et. al. (1997) Mol. Pharmacol. 51, 491.
    2. Zarayskiy, V.V. et al. (2005) Toxicon 45, 431.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.
      Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.
      Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV), before (black) and during (green) application of 100 nM Heteropodatoxin-2 (#STH-340). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2, taken from the experiment in A.
    References - Scientific background
    1. Sanguinetti, M.C. et. al. (1997) Mol. Pharmacol. 51, 491.
    2. Bernard, C. et al. (2000) Protein Science 9, 2059.
    3. Zarayskiy, V.V. et al. (2005) Toxicon 45, 431.
    Scientific background Heteropodatoxin-2 is a synthetic peptide purified to homogeneity, originally isolated from the Heteropoda venatoria spider venom1,2. Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Heteropodatoxin-2 lacks affinity for KV1.4, KV2.1 and KV3.41,3. It also blocks Ca2+ channels1.
    Target KV4 K+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    Last update: 11/04/2021

    Heteropodatoxin-2 (#STH-340) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Meneses, D. et al. (2016) Neural Plast. 2016, 8782518.
    2. Sandler, M. et al. (2016) Neuron 90, 1028.
    3. Min, M.Y. et al. (2010) Neuroscience 168, 633.
    4. Norris, A.J. and Nerbonne, J.M. (2010) J. Neurosci. 30, 5092.

    Related Products

    Shipping and Ordering information

    Resources

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us