Heteropodatoxin-2

κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2
A Potent Blocker of KV4 K+ Channels
Cat #: STH-340
Alternative Name κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Heteropoda venatoria (Brown huntsman spider).
    Source Synthetic peptide
    MW: 3413 Da.
    Purity: >98% (HPLC)
    Effective concentration 100-500 nM.
    Sequence DDCGKLFSGCDTNADCCEGYVCRLWCKLDW.
    Modifications Disulfide bonds between Cys3-Cys17, Cys10-Cys22, and Cys16-Cys26. Trp30 - C-terminal amidation.
    Molecular formula C144H213N39O46S6.
    Activity Heteropodatoxin-2 is an inhibitor of voltage-gated Kchannels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Lacks affinity for KV1.4, KV2.1 and KV3.41,2. Also blocks Ca2+ channels1.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.
        Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV), before (black) and during (green) application of 100 nM Heteropodatoxin-2 (#STH-340). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2, taken from the experiment in A.
      • Heteropodatoxin-2 is a synthetic peptide purified to homogeneity, originally isolated from the Heteropoda venatoria spider venom1,2. Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Heteropodatoxin-2 lacks affinity for KV1.4, KV2.1 and KV3.41,3. It also blocks Ca2+ channels1.
    Target KV4 K+ channels
    Net Peptide Content: 100%
    Last update: 28/05/2019

    Heteropodatoxin-2 (#STH-340) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products