Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Jingzhaotoxin-V

JzTx-V, β-Theraphotoxin-Cj2a, β-TRTX-Cj2a, Peptide F8-15.73
A Potent Inhibitor of NaV Channels and KV4.2 and KV4.3 Channels
Cat #: STJ-050
Alternative Name JzTx-V, β-Theraphotoxin-Cj2a, β-TRTX-Cj2a, Peptide F8-15.73
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide originated from Chilobrachys jingzhao (Chinese earth tiger tarantula).
    MW: 3605.4 Da.
    Purity: >98% (HPLC)
    Effective concentration 5-10 nM.
    Sequence YCQKWMWTCDSKRACCEGLRCKLWCRKII.
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, Cys15-Cys25. Ile29 - C-terminal amidation.
    Molecular formula C157H243N47O37S7.
    Activity Jingzhaotoxin-V inhibits TTX-resistant and TTX-sensitive Na+ channels in DRG neurons. It also highly inhibits KV4.2 and KV4.3 K+ channels and weakly inhibits KV2.1 K+ channels. It has no effect on KV1.2, KV1.3 or KV1.4 K+ channels1,2.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs Jingzhaotoxin-V inhibits NaV1.7 channels heterologously expressed in HEK293 cells.
        NaV1.7 currents were elicited by 30 ms voltage ramp from the holding potential of -100 mV to +60 mV, applied every 10 sec using whole-cell voltage clamp technique. A. Time course of NaV1.7 current amplitude changes before (black) and during (green) application of 10 nM Jingzhaotoxin-V (#STJ-050) indicated by the horizontal bar. B. Superimposed example current traces of NaV1.7 currents before (black) and during (green) 200 sec application of 10 nM Jingzhaotoxin-V, as indicated.
      • Zeng, X.Z. et al. (2007) Toxicon  49, 388.
      • Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431.

      • Jingzhaotoxin-V is a 29 amino acid peptidyl toxin isolated from the Chilobrachys jingzhao (Chinese earth tiger tarantula) spider1. It significantly inhibits tetrodotoxin-resistant (TTX-R) and tetrodotoxin-sensitive (TTX-S) Na+ channels in adult rat DRG neurons as well as KV4.2 K+ channels expressed in Xenopus laevis oocytes1.

        It was found that Jingzhaotoxin-V alters the gating properties of Na+ channels by shifting the activation curves to the depolarizing direction and the inactivation curves to the hyperpolarizing direction1. The findings related to this peptide further reinforced the viewpoint that gating-modifier toxins can alter the voltage-dependent gating through the lipid membrane partitioning1.
    Target NaV channels, KV4.2, KV4.3 channels
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 50 µg free trial sample!
    Last update: 09/07/2019

    Jingzhaotoxin-V (#STJ-050) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products
        •