Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Jingzhaotoxin-V

JzTx-V, β-Theraphotoxin-Cj2a, β-TRTX-Cj2a, Peptide F8-15.73

A Potent Inhibitor of NaV Channels and KV4.2 and KV4.3 Channels

Cat #: STJ-050
Alternative Name JzTx-V, β-Theraphotoxin-Cj2a, β-TRTX-Cj2a, Peptide F8-15.73
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3605.4 Da
    Purity: >98% (HPLC)
    Effective concentration 5-10 nM.
    Sequence YCQKWMWTCDSKRACCEGLRCKLWCRKII.
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, Cys15-Cys25. Ile29 - C-terminal amidation.
    Structure
    Molecular formula C157H243N47O37S7.
    Activity Jingzhaotoxin-V inhibits TTX-resistant and TTX-sensitive Na+ channels in DRG neurons. It also highly inhibits KV4.2 and KV4.3 K+ channels and weakly inhibits KV2.1 K+ channels. It has no effect on KV1.2, KV1.3 or KV1.4 K+ channels1,2.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Jingzhaotoxin-V inhibits NaV1.7 channels heterologously expressed in HEK293 cells.
      Alomone Labs Jingzhaotoxin-V inhibits NaV1.7 channels heterologously expressed in HEK293 cells.
      NaV1.7 currents were elicited by 30 ms voltage ramp from the holding potential of -100 mV to +60 mV, applied every 10 sec using whole-cell voltage clamp technique. A. Time course of NaV1.7 current amplitude changes before (black) and during (green) application of 10 nM Jingzhaotoxin-V (#STJ-050) indicated by the horizontal bar. B. Superimposed example current traces of NaV1.7 currents before (black) and during (green) 200 sec application of 10 nM Jingzhaotoxin-V, as indicated.
    References - Scientific background
    1. Zeng, X.Z. et al. (2007) Toxicon  49, 388.
    2. Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431.
    Scientific background

    Jingzhaotoxin-V is a 29 amino acid peptidyl toxin isolated from the Chilobrachys jingzhao (Chinese earth tiger tarantula) spider1. It significantly inhibits tetrodotoxin-resistant (TTX-R) and tetrodotoxin-sensitive (TTX-S) Na+ channels in adult rat DRG neurons as well as KV4.2 K+ channels expressed in Xenopus laevis oocytes1.

    It was found that Jingzhaotoxin-V alters the gating properties of Na+ channels by shifting the activation curves to the depolarizing direction and the inactivation curves to the hyperpolarizing direction1. The findings related to this peptide further reinforced the viewpoint that gating-modifier toxins can alter the voltage-dependent gating through the lipid membrane partitioning1.

    Target NaV channels, KV4.2, KV4.3 channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 29/08/2021

    Jingzhaotoxin-V (#STJ-050) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us