Huwentoxin-I

µ/ω-Theraphotoxin-Hh1a, µ/ω-TRTX-Hh1a, Huwentoxin-1, HwTx-I
An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs
    Cat #: STH-050
    Alternative Name µ/ω-Theraphotoxin-Hh1a, µ/ω-TRTX-Hh1a, Huwentoxin-1, HwTx-I
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3750 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 50-200 nM.
    Sequence ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys22, and Cys16-Cys29.
    Structure
    • Huwentoxin-I
    Molecular formula C161H246N48O44S6.
    Activity An inhibitor of TTX-sensitive voltage-gated Na+ channels and N-type voltage-gated Ca2+ channels1. Also found to block neuromuscular transmission2.
    References-Activity
    1. Wang, M. et al. (2007) Biochem. Biophys. Res. Comm. 357, 579.
    2. Zhou, P.A. et al. (1997) Toxicon 35, 39.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Huwentoxin-I
      Alomone Labs Huwentoxin-I inhibits NaV1.7 currents heterologously expressed in HEK-293 cells.
      A. Time course of Huwentoxin-I (#STH-050) blocking action on NaV1.7 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 20 ms voltage step to -30 mV. 200 nM Huwentoxin-I were perfused as indicated by the bar (green) during 350 sec.  B. Superimposed examples of NaV1.7 channel current in the absence (control) and presence (green) of 200 nM Huwentoxin-I (taken from the experiment in A).
    References - Scientific background
    1. Wang, M. et al. (2012) Peptides 34, 19.
    2. Meng, E. et al. (2011) PLoS One 6, e21608.
    3. Chen, J.Q. et al. (2005) Toxicon 45, 15.
    4. Zhou, P.A. et al. (1997)Toxicon 35, 39.
    Scientific background

    Huwentoxin-I (HwTx-I) is a 33-residue peptide toxin that was originally isolated from the venom of the Chinese bird spider Ornithoctonus huwena. Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated Na+ channels (TTX-S) with IC50 values of ~50 nM and N-type voltage-sensitive Ca2+ channels with IC50 values of ~100 nM in mammalian DRG, hippocampus and insect DUM neurons1. It has only a very weak effect on L-type Ca2+ channels, no effect on TTX-R channels and has virtually no effect on muscle Na+ channels. The selectivity of Huwentoxin-I for Ca2+ channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA2. Huwentoxin-I demonstrates an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~0.28 µg/kg), without side effects of the ones caused by ω-conotoxin MVIIA3.

    Huwentoxin-I also blocks neuromuscular transmission by acting on nAChR4.

    Target N-type CaV, TTX-sensitive NaV channels, nAChR
    Net Peptide Content: 100%
    Last update: 26/01/2020

    Huwentoxin-I (#STH-050) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information