Jingzhaotoxin-XII

κ-theraphotoxin-Cj2a, κ-TRTX-Cj2a, Jingzhaotoxin-12, JZTX-12, JZTX-XII, Jingzhaotoxin-45, JZTX-45, Peptide F4-20.99
A Blocker of KV4.1 and NaV1.5 Voltage-Gated Channels
    Cat #: STJ-100
    Alternative Name κ-theraphotoxin-Cj2a, κ-TRTX-Cj2a, Jingzhaotoxin-12, JZTX-12, JZTX-XII, Jingzhaotoxin-45, JZTX-45, Peptide F4-20.99
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3665 Da.
    Purity: >98% (HPLC)
    Effective concentration 200 nM - 2 µM.
    Sequence YCQKWMWTCDSERKCCEGYVCELWCKYNL.
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, Cys15-Cys25. Leu29-C-terminal amidation.
      • Jingzhaotoxin-XII
    Molecular formula C161H227N41O44S7.
    Activity Jingzhaotoxin-XII inhibits KV4.1 and NaV1.5 voltage-gated channels1,2.
      • Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431.
      • Yuan, C. et al. (2007) Toxicon 50, 646.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Jingzhaotoxin-XII
        Alomone Labs Jingzhaotoxin-XII inhibits KV4.1 currents in transiently transfected HEK293T cells.
        A. Time course of Jingzhaotoxin-XII (#STJ-100) action. Peak current amplitude was plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 20 seconds by a voltage step of 80 msec from holding potential to 0 mV. 2 µM Jingzhaotoxin-XII was perfused in the period marked by the horizontal bar (green), indicating the inhibitory effect of Jingzhaotoxin-XII. B. Superimposed traces of KV4.1 currents under control conditions and after 3 min application of 2 µM Jingzhaotoxin-XII (green, as indicated).
    References - Scientific background
    • 1. Zhou, W. et al. (2004) Neuron 41, 573.
    • 2. Serodio, P. et al. (1998) J. Neurophysiol. 79, 1081.
    • 3. Rong, M. et al. (2011) FASEB J. 25, 3177.
    • 4. Liao, Z. et al. (2007) Toxicon 1, 1.
    • 5. Yuan, C. et al. (2007) Toxicon 50, 646.
    • 6. Xiao, Y. et al. (2004) J. Biol. Chem. 279, 26220.
    • 7. Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431.
    • 8. Yuan, C. et al. (2007) Toxicon 50, 646.
      • Voltage-gated K+ (KV) channels play important roles in regulating the excitability of myocytes and neurons. KV channel α subunits are divided into four major subfamilies, KV1 through KV41. The KV4 (Shal) subfamily comprises three distinct genes, KV4.1, KV4.2, and KV4.32.

        Voltage-gated Na+ channels play an important role in generating action potentials. NaV channels consists nine different α subunits, NaV1.1 through NaV1.93.

        Jingzhaotoxin-XII (JZTX-XII), a 29-residue polypeptide, isolated from the venom of Chinese tarantula Chilobrachys jingzhao. JZTX-XII is specific for the Kv4.1 channel and has high selectivity to the NaV channel isoform expressed in cardiac myocytes. It interacts with the channels by modifying the gating behavior4. JZTX-XII blocks KV4.1 currents with an IC50 value of 363 nM in X. laevis oocytes5 and can inhibit NaV1.5 with an IC50 value of 348 nM6.

    Target KV4.1, NaV1.5 channels
    Net Peptide Content: 100%
    Last update: 24/01/2020

    Jingzhaotoxin-XII (#STJ-100) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use