Name: MmTx1 Toxin
Brand: Alomone Labs
SKU: STM-550

Cat #: STM-550

Alternative Name Micrurotoxin 1

Lyophilized Powder yes

Bioassay Tested

Origin Synthetic peptide

MW: 7205 Da

Purity: >99% (HPLC)

Form Lyophilized powder.

Effective concentration 100-400 nM.

Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCCTRDNCN.

Modifications Cys³-Cys²⁴, Cys⁶-Cys¹¹, Cys¹⁷-Cys⁴¹, Cys⁴⁵-Cys⁵⁷, Cys⁵⁸-Cys⁶³.

Structure

Molecular formula C₂₉₅H₄₅₅N₉₅O₉₇S₁₀.

Activity MmTx1 is a potent allosteric modulator of GABA(A) receptors¹.

References-Activity

Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.

Accession number C0HJR1.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Our bioassay

Alomone Labs MmTx1 Toxin (200 nM) modulates GABA(A) receptors expressed in Xenopus oocytes.
A. Representative time course of GABA(A) α1/β2 current activated at a holding potential of -80 mV by 100 nM Muscimol hydrobromide (#M-240) applications (black bars), and modulated by co-application of 200 nM MmTx1 Toxin (#STM-550), as indicated (green bar). A significant modulation of receptor desensitization and reactivation rates is observed. B. Superimposed traces of GABA(A) receptor currents upon application of 100 nM Muscimol (black) or co-application of 100 nM Muscimol and 200 nM MmTx1 Toxin (green). Taken from the recording in A.
Alomone Labs MmTx1 Toxin (400 nM) modulates GABA(A) receptors expressed in Xenopus oocytes.
A. Representative time course of GABA(A) α1/β2 current activated at a holding potential of -80 mV by 100 nM Muscimol hydrobromide (#M-240) applications (black bars), and modulated by co-application of 400 nM MmTx1 Toxin (#STM-550), as indicated (green bar). A significant modulation of receptor desensitization and reactivation rates is observed. B. Superimposed traces of GABA(A) currents upon application of 100 nM Muscimol (black) or co-application of 100 nM Muscimol and 400 nM MmTx1 Toxin (green). Taken from the recording in A.

References - Scientific background

Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
Middendorp, S.J. et al. (2015) Neuropharmacology 95, 459.

Scientific background

MmTx1 (Micrurotoxin 1) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors and tightly binds to these receptors at subnanomolar concentrations. MmTx1 allosterically increases GABA(A) receptor susceptibility to agonistic actions, thereby modulating receptor opening and desensitization by interacting with the α⁺/β⁻interface, a benzodiazepine-like binding site¹. MmTx1 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity¹.

GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system².

Target GABA(A) receptors

Peptide Content: 100%

Lyophilized Powder

Last update: 03/01/2023

MmTx1 Toxin (#STM-550) is a highly pure, synthetic, and biologically active peptide toxin.

Order Summary

MmTx1 Toxin

Applications

Citations

Specifications

Scientific Background

Related Products

Need Help With This Product?