-
New New
This product has recently been released.
Cat #: STM-550
Sizes: 50 µg, 0.1 mg, 0.5 mg, 1 mg 
Lyophilized Powder Lyophilized Powder
This product is freeze dried. All water molecules have been removed.
Bioassay Tested Bioassay Tested
The activity of this product has been verified and approved by our professional team.
Our Bioassay
Shipped at Room Temp. Shipped at Room Temp.
This lyophilized product is shipped at room temperature. Please see its certificate of analysis for further storage instructions.
100% Net Peptide 100% Net Peptide
This vial contains 100% net peptide content.
Origin Micrurus mipartitus (Red-tailed coral snake).
Source: Synthetic peptide
MW: 7205 Da.
Purity >99%.
Formulation Lyophilized powder.
Effective concentration 100-400 nM.
Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCCTRDNCN.
Modifications Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63.
Molecular formula C295H455N95O97S10.
Activity MmTX1 is a potent allosteric modulator of GABA(A) receptors1.
Storage before reconstitution Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
Our bioassay Alomone Labs MmTX1 modulates GABA(A) receptors expressed in Xenopus oocytes.
A. Representative time course of GABA(A) α1/β2 current activated at a holding potential of -80 mV by 100 nM
Muscimol hydrobromide (#M-240) applications (black bars), and modulated by co-application of 200 nM
MmTX1 (#STM-550), as indicated (green bar). A significant modulation of receptor desensitization and reactivation rates is observed. B. Superimposed traces of GABA(A) receptor currents upon application of 100 nM Muscimol (black) or co-application of 100 nM Muscimol and 200 nM MmTX1 (green). Taken from the recording in A.
Alomone Labs MmTX1 modulates GABA(A) receptors expressed in Xenopus oocytes.
A. Representative time course of GABA(A) α1/β2 current activated at a holding potential of -80 mV by 100 nM
Muscimol hydrobromide (#M-240) applications (black bars), and modulated by co-application of 400 nM
MmTX1 (#STM-550), as indicated (green bar). A significant modulation of receptor desensitization and reactivation rates is observed. B. Superimposed traces of GABA(A) currents upon application of 100 nM Muscimol (black) or co-application of 100 nM Muscimol and 400 nM MmTX1 (green). Taken from the recording in A.
References Rosso, J.P. et al. (2015)
Proc. Natl. Acad. Sci. U.S.A. 112, E891.
Middendorp, S.J. et al. (2015)
Neuropharmacology 95, 459.
Scientific background MmTX1 (Micrurotoxin 1) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors (GABA(A)) and tightly binds to GABA(A) receptors at subnanomolar concentrations. MmTX1 allosterically increases GABA(A) receptor susceptibility to agonistic actions, thereby potentiating receptor opening and desensitization by interacting with the α+/β−interface, a benzodiazepine-like binding site1. MmTX1 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABAA receptor activity1.
(GABAA) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.
Target: GABA(A) receptors
Net Peptide Content: 100%
Lyophilized Powder
Last update: 10/05/2018
MmTX1 (#STM-550) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
