Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Ligand-Gated Ion Channels › GABA(A) Receptors › Agonists

MmTx2 Toxin

Micrurotoxin 2

A Super Potent Allosteric Modulator of GABA(A) Receptors

Cat #: STM-600
Alternative Name Micrurotoxin 2
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 7187 Da
    Purity: >99% (HPLC)
    Form Lyophilized powder.
    Effective concentration 100-400 nM.
    Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN.
    Modifications Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63
    Structure
    Molecular formula C295H450N94O97S10.
    Activity MmTx2 is a potent allosteric modulator of GABA(A) receptors1.
    References-Activity
    1. Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
    Accession number C0HJR2.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs MmTx2 Toxin modulates GABA(A) receptors expressed in Xenopus oocytes.
      Alomone Labs MmTx2 Toxin modulates GABA(A) receptors expressed in Xenopus oocytes.
      A. Representative time course of GABA(A) α1/β2 currents activated at a holding potential of -80 mV with 50 nM Muscimol hydrobromide (#M-240) application (black bars), and modulated by co-application of 200 nM MmTx2 Toxin (#STM-600), as indicated (green bar). A significant modulation of receptor desensitization rate is observed. B. Superimposed traces of GABA(A) currents upon application of 50 nM Muscimol hydrobromide (black) or co-application of 50 nM Muscimol hydrobromide and 200 nM MmTx2 Toxin (green). Taken from the recording in A.
    References - Scientific background
    1. Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
    2. Middendorp, S.J. et al. (2015) Neuropharmacology 95, 459.
    Scientific background

    MmTx2 (Micrurotoxin 2) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors and tightly binds to these receptors at subnanomolar concentrations. MmTx2 allosterically increases GABA(A) receptor susceptibility to agonistic actions1. Like MmTx1 (#STM-550), MmTx2 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.

    GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.

    Target GABA(A) receptors
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 02/01/2022

    MmTx2 Toxin (#STM-600) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us