-
New New
This product has recently been released.
Lyophilized Powder Lyophilized Powder
This product is freeze dried. All water molecules have been removed.
Bioassay Tested Bioassay Tested
The activity of this product has been verified and approved by our professional team.
Our Bioassay
Origin Micrurus mipartitus (Red-tailed coral snake).
Source Synthetic peptide
MW: 7187 Da.
Purity: >99% (HPLC)
Formulation Lyophilized powder.
Effective concentration 100-400 nM.
Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN.
Modifications Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63
Molecular formula C295H450N94O97S10.
Activity MmTX2 is a potent allosteric modulator of GABA(A) receptors1.
References - Activity Rosso, J.P. et al. (2015)
Proc. Natl. Acad. Sci. U.S.A. 112, E891.
Storage before reconstitution Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
Our bioassay Alomone Labs MmTX2 modulates GABA(A) receptors expressed in Xenopus oocytes.
A. Representative time course of GABA(A) α1/β2 currents activated at a holding potential of -80 mV with 50 nM
Muscimol hydrobromide (#M-240) application (black bars), and modulated by co-application of 200 nM
MmTX2 (#STM-600), as indicated (green bar). A significant modulation of receptor desensitization rate is observed. B. Superimposed traces of GABA(A) currents upon application of 50 nM Muscimol hydrobromide (black) or co-application of 50 nM Muscimol hydrobromide and 200 nM MmTX2 (green). Taken from the recording in A.
References - Scientific Background Rosso, J.P. et al. (2015)
Proc. Natl. Acad. Sci. U.S.A. 112, E891.
Middendorp, S.J. et al. (2015)
Neuropharmacology 95, 459.
Scientific background MmTX2 (Micrurotoxin 2) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors and tightly binds to these receptors at subnanomolar concentrations. MmTX2 allosterically increases GABA(A) receptor susceptibility to agonistic actions1. Like MmTX1 (#STM-550), MmTX2 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.
GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.
Target GABA(A) receptors
Net Peptide Content: 100%
Lyophilized Powder
Last update: 25/11/2018
MmTX2 (#STM-600) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
