Home › Products › Ion Channels › Ligand-Gated Ion Channels › GABA(A) Receptors › Agonists

MmTx2 Toxin

Micrurotoxin 2
A Super Potent Allosteric Modulator of GABA(A) Receptors
    Cat #: STM-600
    Alternative Name Micrurotoxin 2
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 7187 Da.
    Purity: >99% (HPLC)
    Form Lyophilized powder.
    Effective concentration 100-400 nM.
    Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN.
    Modifications Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63
      • MmTx2 Toxin
    Molecular formula C295H450N94O97S10.
    Activity MmTx2 is a potent allosteric modulator of GABA(A) receptors1.
      • Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
    Accession number C0HJR2.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • MmTx2 Toxin
        Alomone Labs MmTx2 Toxin modulates GABA(A) receptors expressed in Xenopus oocytes.
        A. Representative time course of GABA(A) α1/β2 currents activated at a holding potential of -80 mV with 50 nM Muscimol hydrobromide (#M-240) application (black bars), and modulated by co-application of 200 nM MmTx2 Toxin (#STM-600), as indicated (green bar). A significant modulation of receptor desensitization rate is observed. B. Superimposed traces of GABA(A) currents upon application of 50 nM Muscimol hydrobromide (black) or co-application of 50 nM Muscimol hydrobromide and 200 nM MmTx2 Toxin (green). Taken from the recording in A.
    References - Scientific background
    • 1. Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
    • 2. Middendorp, S.J. et al. (2015) Neuropharmacology 95, 459.

      • MmTx2 (Micrurotoxin 2) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors and tightly binds to these receptors at subnanomolar concentrations. MmTx2 allosterically increases GABA(A) receptor susceptibility to agonistic actions1. Like MmTx1 (#STM-550), MmTx2 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.

        GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.

    Target GABA(A) receptors
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 50 µg free trial sample!
    Last update: 20/08/2019

    MmTx2 Toxin (#STM-600) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products