MmTx2 Toxin

Micrurotoxin 2
A Super Potent Allosteric Modulator of GABA(A) Receptors
Cat #: STM-600
Alternative Name Micrurotoxin 2
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide originated from Micrurus mipartitus (Red-tailed coral snake).
    MW: 7187 Da.
    Purity: >99% (HPLC)
    Form Lyophilized powder.
    Effective concentration 100-400 nM.
    Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN.
    Modifications Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63
    Molecular formula C295H450N94O97S10.
    Activity MmTx2 is a potent allosteric modulator of GABA(A) receptors1.
      • Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs MmTx2 Toxin modulates GABA(A) receptors expressed in Xenopus oocytes.
        A. Representative time course of GABA(A) α1/β2 currents activated at a holding potential of -80 mV with 50 nM Muscimol hydrobromide (#M-240) application (black bars), and modulated by co-application of 200 nM MmTx2 Toxin (#STM-600), as indicated (green bar). A significant modulation of receptor desensitization rate is observed. B. Superimposed traces of GABA(A) currents upon application of 50 nM Muscimol hydrobromide (black) or co-application of 50 nM Muscimol hydrobromide and 200 nM MmTx2 Toxin (green). Taken from the recording in A.
      • MmTx2 (Micrurotoxin 2) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors and tightly binds to these receptors at subnanomolar concentrations. MmTx2 allosterically increases GABA(A) receptor susceptibility to agonistic actions1. Like MmTx1 (#STM-550), MmTx2 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.

        GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.

    Target GABA(A) receptors
    Net Peptide Content: 100%
    Last update: 27/06/2019

    MmTx2 Toxin (#STM-600) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use