Pandinotoxin Kα

Potassium channel toxin α-KTx 7.1, Pandinotoxin-α, Potassium channel-blocking toxin 2, Pi-2, Pi2, Toxin PiTX-K-α, PiTX-Kα
A Blocker of A-Type and Shaker-Related Voltage-Gated K+ Channels
    Cat #: STP-500
    Alternative Name Potassium channel toxin α-KTx 7.1, Pandinotoxin-α, Potassium channel-blocking toxin 2, Pi-2, Pi2, Toxin PiTX-K-α, PiTX-Kα
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4033 Da.
    Purity: >98% (HPLC)
    Effective concentration 10-200 nM.
    Sequence TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR.
    Modifications Disulfide bonds between Cys4-Cys25, Cys10-Cys30, Cys14-Cys32.
      • Pandinotoxin Kα
    Molecular formula C169H267N53O48S7.
    CAS No.: 185529-64-0.
    Activity Pandinotoxin Kα is an A-type and Shaker-related K+ channel blocker1-4.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Pandinotoxin Kα
        Alomone Labs Pandinotoxin Kα inhibits KV1.2 channels heterologously expressed in Xenopus oocytes.
        A. Time course of Pandinotoxin Kα (#STP-500) action on KV1.2 currents.  KV1.2 currents were elicited by 100 ms voltage ramp from the holding potential of -80 mV to +10 mV. 10 nM and 100 nM Pandinotoxin Kα were perfused as indicated by the bars at -10 mV. B. Superimposed examples of KV1.2 channel current in the absence (control) and presence of 10 nM or 100 nM Pandinotoxin Kα (taken from the experiment in A).
    References - Scientific background
      • Scorpion venoms are a rich source of ion channel modulators. The scorpion toxins have been useful molecules in probing the K+ channel structures and functions1.

        Pandinotoxin Kα (PiTx-Kα) is a 35 amino acid peptidyl toxin isolated from the Pandinus imperator (Emperor scorpion) venom. It is a highly potent and selective blocker of voltage-activated K+ channels. PiTx-Kα preferentially blocks rapidly inactivating (A-type) K+ channels2. In general, channel inhibitors can be pore blockers or gating modifiers. Pore blockers bind to the channel in 1:1 stoichiometry and plug the pore of the channel impeding the flow of the ionic current. These toxins are small proteins that block the passage of K+ ions by binding at the pore entryway on the extracellular side of the channel, thereby inhibiting the ion flux3. The interactions of toxins with K+ channels are among the strongest and most specific known in protein-protein complexes4.

    Target A-type and Shaker-related K+ channels
    Net Peptide Content: 100%
    Last update: 24/01/2020

    Pandinotoxin Kα (#STP-500) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use