Alternative Name κ-theraphotoxin-Ps1b, κ-TRTX-Ps1b, PaTX2, Kappa-theraphotoxin-Ps1b
Lyophilized Powder yes
Bioassay Tested
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Synthetic peptide
MW: 3922 Da
Purity: >99% (HPLC)
Effective concentration 100-500 nM
Sequence YCQKWMWTCDEERKCCEGLVCRLWCKRIINM-NH2
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25
Met31 - C-terminal methionine amide
Met31 - C-terminal methionine amide
Structure
Molecular formula C169H259N49O43S8
CAS No.: 221889-63-0
Activity Phrixotoxin-2 specifically and reversibly blocks KV4.21.
Accession number P61231
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10,000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Phrixotoxin-2 inhibits KV4.2 channel expressed in Xenopus oocytes.A. Time course of Phrixotoxin-2 (#STP-710) action on KV4.2 peak current amplitude. Peak current amplitudes were plotted as a function of time. Membrane potential was held at -90 mV and oocytes were stimulated by a 100 ms voltage step to 0 mV. 200 nM Phrixotoxin-2 was perfused as indicated by the bar (green) for 160 sec. B. Superimposed examples of KV4.2 channel maximum peak current in the absence (control) and presence (green) of 200 nM Phrixotoxin-2 (taken from the experiment in A).
References - Scientific background
- Diochot, S. et al. (1999) Br. J. Pharmacol. 126, 251.
Scientific background Phrixotoxin-2 is a natural peptide isolated from the Phrixotrichus auratus Tarantula venom. It blocks specifically and reversibly KV4.2 and KV4.3 channels.1 These channels are probably the molecular counterparts of the A-type current (Ito1) in the heart. Cloned KV4.2 and KV4.3 channels heterologously expressed in COS cell were blocked with IC50 of 34 and 71 nM of Phrixotoxin-2 respectively1.
Target KV4 channels
Peptide Content: 100%
Lyophilized Powder
Last update: 08/11/2022
Phrixotoxin-2 (#STP-710) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Applications
Citations
Citations
Powered by BiozProduct citations
- Meneses, D. et al. (2016) Neural Plast. 2016, 8782518.
- Subramaniam, M. et al. (2014) J. Neurosci. 34, 13586.
Specifications
Scientific Background
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us
