Free shipping starts now, no minimum, no coupons required!

Psalmotoxin-1

PcTx-1, PcTx1, π-Theraphotoxin-Pc1a, Psalmotoxin 1

A Potent Blocker of ASIC1a Channels

Cat #: STP-200
Alternative Name PcTx-1, PcTx1, π-Theraphotoxin-Pc1a, Psalmotoxin 1
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4689.5 Da
    Purity: >99% (HPLC)
    Effective concentration 1-10 nM.
    Sequence EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT.
    Modifications Disulfide bonds between Cys3-Cys18, Cys10-Cys23 and Cys17-Cys33.
    Structure
    Molecular formula C200H312N62O57S6.
    Activity Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2.
    References-Activity
    1. Chen, X. et al. (2005) J. Gen. Physiol. 126, 71.
    2. Chen, X. et al. (2006) J. Gen. Physiol. 127, 267.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Psalmotoxin-1 inhibits cation currents of ASIC1a expressed in Xenopus oocytes.
      Alomone Labs Psalmotoxin-1 inhibits cation currents of ASIC1a expressed in Xenopus oocytes.
      Membrane potential was held at 5 mV and whole cell currents were continuously recorded using TEVC. ASIC1a currents were elicited by rapid (~2 sec) exposure to pH 5 in physiological solution (indicated by arrows). During the time indicated by the horizontal bar, 5 nM, 10 nM and 20 nM Psalmotoxin-1 (#STP-200) were introduced into the bath via perfusion. 20 nM Psalmotoxin-1 resulted in a complete, yet fairly reversible inhibition of the pH dependent inward transients.
    References - Scientific background
    1. Escoubas, P. et al. (2000) J. Biol. Chem. 275, 25116.
    2. Sluka, S.P. et al. (2007) Pain 129, 102.
    3. Jastil, J. et al. (2007) Nature 449, 316.
    4. Mazzuca, M. et al. (2007) Nat. Neurosci. 10, 943.
    5. Narasimhan, L. et al. (1994) Nat. Struct. Biol. 1, 850.
    6. Pallaghy, P. K. et al. (1994) Protein Sci. 3, 1833.
    7. Salinas, M. et al. (2005) J. Physiol. 570, 339.
    Scientific background

    Native Psalmotoxin1 (PcTx1) is a 40-amino acid toxin originally isolated from the venom of the South American tarantula Psalmopoeus cambridgei.1

    PcTX1 is characterized by the unusual quadruplet Lys25-Arg26-Arg27-Arg28, which probably forms a strongly positive "patch" at the surface of the toxin molecule, constituting an area that is a strong candidate for channel binding site recognition. The molecular scaffold of PcTX1 is likely to be similar to that previously described for both cone snail and spider toxins5,6 and comprises a triple-stranded antiparallel β-sheet structure reticulated by three disulfide bridges.1

    PcTx1 potently (IC50 = 0.9 nM) and specifically blocks a particular subclass of H+-gated cation channels, the Acid-sensing ion channels 1a (ASIC1a) and is able to discriminate between the two splice variant subtypes and not block the ASIC1b channel (which differs only in its N-terminal sequence). Moreover, PcTX1 loses its capacity to block ASIC1a as soon as this subunit is associated with another member of the family (ASIC2a or ASIC3).1

    The ASICs are abundant in the brain and spinal cord neurons and are implicated in pain sensation, ischemic stroke mechanosensation, learning and memory.2,3 In acute and neuropathic pain models, specific blockage of ASIC1a with PcTx1 results in analgesic effects working upstream of the opiate receptors.4

    Using an iodinated form of the toxin, the binding for the PcTX1 site identifies at the cysteine-rich domains I and II (CRDI and CRDII) of the extracellular loop of ASIC1a. A disulphide bridge between domains 1 and 4 of the channel supports a close relationship between the CRDI4–CRDII domain, where PcTx1 acts, and the post-M1 region, the binding site for the proton.7

    Target ASIC1a channels
    Peptide Content: 100%
    Image & Title

    Psalmotoxin-1
    Alomone Labs Psalmotoxin-1 inhibits ASIC1a in mouse MNTB neurons.IASICs in mouse neurons of the medial nucleus of the trapezoid body (MNTB) were activated by a drop in pH from 7.3 to 6.0. Application of 10 nM Psalmotoxin-1 (#STP-200) almost abolished IASICs suggesting that ASIC1a homomers make up the majority of IASICs in MNTBs.Adapted from Gonzalez-Inchauspe, C. et al. (2017) J. Neurosci. 37, 2589. with permission of the Society for Neuroscience.

    Last update: 08/06/2021

    Psalmotoxin-1 (#STP-200) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Zhou, R.P. et al. (2018) Gene 642, 230.
    2. Gonzalez-Inchauspe, C. et al. (2017) J. Neurosci. 37, 2589.
    3. Gu, X.S. et al. (2016) Neurochem. Res. 41, 2923.
    4. Joeres, N. et al. (2016) Sci. Rep. 6, 27647.
    5. Wang, Y.C. et al. (2015) J. Neuroinflammation 12, 246.
    6. Mango, D. et al. (2014) Pharmacol. Res. 81, 83.
    7. Sun, X. et al. (2014) Acta Biochim. Biophys. Sin. 46, 774.
    8. Wu, P.Y. et al. (2013) J. Neurosci. 33, 1828.
    9. Xiong, Q.J. et al. (2012) Am. J. Physiol. 303, C376.
    10. Sun, X. et al. (2011) Brain Res. 1396, 77.
    11. Wu, W.N. et al. (2011) Br. J. Pharmacol. 164, 1445.
    12. Springauf, A. and Gründer, S. (2010) J. Physiol. 588.5, 809.
    Shipping and Ordering information