Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › ASIC/ENaC/Degenerin Family › Acid-Sensing Ion Channels (ASIC) › Blockers

Mambalgin-1

Mamb-1, Pi-Dp1, Mambalgin 1

A Selective and Reversible ASIC1a Blocker

Cat #: STM-100
Alternative Name Mamb-1, Pi-Dp1, Mambalgin 1
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 6554.5 Da
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 50-200 nM.
    Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK.
    Modifications Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38.
    Structure
    Molecular formula C272H429N85O84S10.
    CAS No.: 1609937-15-6
    Activity Mambalgin-1 is a blocker of ASIC1 channels1,2.
    Accession number P0DKR6.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Mambalgin-1 inhibits ASIC1a channels expressed in Xenopus oocytes.
      Alomone Labs Mambalgin-1 inhibits ASIC1a channels expressed in Xenopus oocytes.
      A. Representative time course of Mambalgin-1 (#STM-100) inhibition of ASIC1a. Currents were elicited every 50 sec by transient application of pH 6, while membrane potential was held at -80 mV, and inhibited by 20 nM and 100 nM Mambalgin-1 (indicated by bars). B. Superimposed traces of ASIC1a currents upon application of control, 20 nM and 100 nM Mambalgin-1 (taken from the recording in A).
    References - Scientific background
    1. Diochot, S. et al. (2012) Nature 490, 552.
    2. Mourier, G. et al. (2016) J. Biol. Chem. 291, 2616.
    Scientific background

    Mambalgin-1 is a 57-residue peptide toxin originally isolated from the black mamba snake venom. It is a selective and reversible acid-sensing ion channel 1 (ASIC1) channel blocker. It binds to the closed state of the channel. The binding induces strong shift of the pH-dependent activation of ASIC1 channel towards a more acidic pH. Mambalgin-1 inhibits homomeric rat ASIC1a, rat ASIC1b, and heteromeric rat ASIC1a + ASIC2a channels heterologously expressed in Xenopus oocytes with an IC50 values of 3.4 ± 0.6, 22.2 ± 1.7, and 152 ± 21 nM, respectively2.

    In mice, Mambalgin-1 is not toxic, but poses analgesic effects upon central and peripheral injection found to be as strong as morphine1,2.

    ASIC channels are proton-gated Na+ channels directly activated by extracellular protons. They are expressed throughout the CNS and the peripheral nervous system. The channels are involved in a variety of physiological and pathophysiological processes including synaptic plasticity, neuronal injury, nociception and mechanoperception2.

    Target ASIC1 channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 08/06/2021

    Mambalgin-1 (#STM-100) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us