Free shipping starts now, no minimum, no coupons required!

Mambalgin-2

Ma-2, Mamb-2, Pi-Dp2

A Selective and Reversible ASIC1a Channel Blocker

Cat #: STM-400
Alternative Name Ma-2, Mamb-2, Pi-Dp2
Lyophilized Powder yes
  • Bioassay Tested
  • Origin

    Synthetic peptide

    MW: 6538 Da
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 20 – 300 nM.
    Sequence LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK.
    Modifications Disulfide bonds between Cys3-Cys19, Cys41-Cys49 and Cys50-Cys55.
    Structure
    Molecular formula C272H429N85O83S10.
    Activity Mambalgin-2 is a blocker of ASIC1 channels1.
    References-Activity
    1. Salinas, M. et al. (2014) J. Biol. Chem. 289, 13363.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Mambalgin-2 inhibits ASIC1a channels expressed in Xenopus oocytes.
      Alomone Labs Mambalgin-2 inhibits ASIC1a channels expressed in Xenopus oocytes.
      A. Representative time course of Mambalgin-2 (#STM-400) inhibition of ASIC1a currents. Membrane potential was held at -80 mV, current was elicited every 50 sec by transient application of pH 5.5, and partially inhibited by 200 nM Mambalgin-2 (top bar). B. Superimposed traces of ASIC1a currents upon application of control and of 200 nM Mambalgin-2 (taken from the recording in A).
    References - Scientific background
    1. Baron, A. et al. (2013) Toxicon 75, 187.
    2. Salinas, M. et al. (2014) J. Biol. Chem. 289, 13363.
    3. Vullo, S. and Kellenberger, S. Pharmacol. Res. (2019) pii: S1043-6618(18)31948-0.
    Scientific background

    Mambalgin-2 is a peptide toxin originally isolated from Dendroaspis polylepis (Black mamba) venom. It is a selective and potent ASIC1a blocker2. Mambalgins belong to the three-finger toxin family, albeit their limited structural similarity3. Molecular docking of mambalgin-2 is predicted to interact with the acidic binding pocket of ASIC1a2. Further mutagenesis studies in chimeric proteins uncovered the interactions of mambalgin-2 with β-ball and Palm regions of ASIC1a that are associated with a pH sensing property2.

    Acid-sensing ion channels (ASICs) are proton-gated sodium channels1. They are abundant in the central as well as in the peripheral nervous systems and are sensitive to environmental pH1.

    Environmental pH can change dramatically due to certain circumstances such as inflammatory condition as evident during epileptic seizures or tumor outgrowth3. In such cases, ASICs transform into their open conformation and import sodium ions, which then elicit neuronal action potential3.

    Target ASIC1 Channels
    Peptide Content: 100%
    Last update: 08/06/2021

    Mambalgin-2 (#STM-400) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Shipping and Ordering information