Name: AaH1 Toxin
Brand: Alomone Labs
SKU: STA-155
Availability: InStock

Cat #: STA-155

Alternative Name Neurotoxin-1, AaH I, AaHI, Neurotoxin I

Lyophilized Powder yes

Bioassay Tested

Origin Synthetic peptide

MW: 6804 Da

Purity: >98% (HPLC)

Form Lyophilized powder.

Effective concentration 1 µM.

Sequence KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVPSGLACWCKDLPDNVPIKDTSRKCT.

Modifications Disulfide bonds between Cys¹²-Cys⁶², Cys¹⁶-Cys^34,Cys²⁰-Cys⁴⁴and Cys²⁴-Cys⁴⁶.

Structure

Molecular formula C₂₉₃H₄₅₂N₈₂O₈₉S₈

Activity AaH1 Toxin is a Na_V channel activator. It blocks the fast inactivation of the channel¹.

References-Activity

Possani, L.D. et al. (1999) Eur. J. Biochem. 264, 287.

Accession number P01479.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Our bioassay

Alomone Labs AaH1 Toxin modulates Na_V1.2 channels expressed in Xenopus oocytes.
A. Representative time course of AaH1 Toxin (#STA-155) effect on the normalized area of Na_V1.2 channel current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec and was significantly enhanced by the application of 1 µM AaH1 Toxin (green). B. Superimposed traces of Na_V1.2 current after application of control (black) and of 1 µM AaH1 Toxin (green), taken from the recording in A.

References - Scientific background

Possani, L.D. et al. (1999) Eur. J. Biochem. 264, 287.
Fabrichny, I.P. et al. (2012) J. Biol. Chem. 287, 14136.
di Tommaso, A. et al. (2012) J. Biol. Chem. 287, 1414.
Chow, C.Y. et al. (2015) Toxins 7, 2494.

Scientific background

AaH1 Toxin is a low molecular weight peptide toxin originally isolated from Androctonus australis scorpion venom. It blocks the fast inactivation phase of voltage-gated Na⁺ channels^1-3. AaH1 Toxin is one of four α-toxins: AahI, AahII, AahIII, and AahIV which account for 95% of the venom lethality².

There are nine mammalian subtypes of voltage-gated sodium (Na_V) channels: Na_V1.1–Na_V1.9. They are responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets in numerous pathophysiological conditions such as cardiac arrhythmia and epilepsy⁴_.

Target Na_V channels

Peptide Content: 100%

Lyophilized Powder

Last update: 08/06/2021

AaH1 Toxin (#STA-155) is a highly pure, synthetic, and biologically active peptide toxin.

Order Summary

AaH1 Toxin

Applications

Specifications

Scientific Background

Citations

Related Products

Need Help With This Product?