Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Activators

ATX-II

Neurotoxin 2, Toxin ATX-II, As2, Anemonia viridis toxin 2, Av2, Delta-actitoxin-Avd1c 2
A Modulator of NaV Channels
    Cat #: STA-700
    Alternative Name Neurotoxin 2, Toxin ATX-II, As2, Anemonia viridis toxin 2, Av2, Delta-actitoxin-Avd1c 2
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4935 Da.
    Purity: >98% (HPLC)
    Effective concentration 10-100 nM.
    Sequence GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ.
    Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34 and Cys27-Cys45.
      • ATX-II
    Molecular formula C213H323N63O61S6.
    CAS No.: 60748-45-0.
    Activity ATX-II potently modulates voltage-gated Na+ channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes. ATX-II has been used as a powerful activator of TTX-sensitive and insensitive Na+ channels in various excitable tissue and cell types1-9.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
      • ATX-II
        Alomone Labs ATX-II enhances hNaV1.5 currents in stably transfected HEK cells.
        hNaV1.5 currents were elicited by a 50 ms voltage step from the holding potential of -100 mV to -20 mV, applied every 20 sec, using whole-cell voltage clamp technique (bath solution contains TEA and pipette solution contains CsF). A. Time course, showing the effect of 0.05 nM, 0.5 nM, 5 nM and 50 nM ATX-II (#STA-700) on the current area, indicating a dose-dependent slowing of the hNaV1.5 inactivation. B. Superimposed traces of hNaV1.5 currents under control conditions and after 4-6 min perfusion with 0.05 nM, 0.5 nM, 5 nM and 50 nM ATX-II, as indicated.
    References - Scientific background
    • 1. Romey, G. et al. (1976) Proc Natl. Acad. Sci. U.S.A. 73, 4055.
    • 2. Tesseraux, I. et al. (1987) Naunyn Schmiedebergs Arch. Pharmacol. 336, 232.
    • 3. Nishio, M. et al. (1991) Br. J. Pharmacol. 104, 504.
    • 4. Cannon, S.C. and Corey D.P. (1993) J. Physiol. 466, 501.
    • 5. Hoey, A. et al. (1994) Pharmacol. Toxicol. 75, 356.
    • 6. Chahine, M. et al. (1996) J. Membr. Biol. 152, 39.
    • 7. Fletcher, J.E. et al. (1999) Anesthesiology 90, 1294.
    • 8. Brand, S. et al. (2000) Eur. J. Neurosci. 12, 2387.
    • 9. Ravens, U. (1976) Naunyn-Schmiedeberg’s Arch. Pharmacol. 296, 73.

      • ATX-II is a 47 amino acid peptidyl toxin, originally isolated from Anemonia sulcata sea anemone venom. It is a potent neurotoxin, which modulates voltage-gated Na+ channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes.

        ATX-II has been used as a powerful activator of TTX-sensitive and -insensitive Na+ channels in various excitable tissue and cell types (at concentration range of 10-100 nM).1-9

    Target Various NaV channels
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 50 µg free trial sample!
    Image & Title ATX-II
    Effects of ATX-II on rabbit cardiomyocytes.    Electrical stimulation-induced changes in [Na+]i in the absence (control) and presence of 5 nM ATX-II (#STA-700).Adapted from Kornyeyev, D. et al. (2016) Am. J. Physiol. 310, H426. with permission of The American Physiological Society.
    Last update: 13/11/2019

    ATX-II (#STA-700) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products