Anti-GIRK1 (Kir3.1) Antibody

KCNJ3, G protein-activated inward rectifier potassium channel 1
Cat #: APC-005
Alternative Name KCNJ3, G protein-activated inward rectifier potassium channel 1
  • KO Validated
  • Lyophilized Powder
  • Antigen Incl.
  • Type: Polyclonal
    Source: Rabbit
    Reactivity: h, m, r
      • GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250), (MW: 34 kDa.). Intracellular, C-terminus.
    Accession (Uniprot) Number P63250
    Gene ID 16519
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Rat - identical; human - 64/66 amino acid residues identical; guinea pig - 63/66 amino acid residues identical; chicken - 59/66 amino acid residues identical.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 0.6 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Control antigen storage before reconstitution Lyophilized powder can be stored intact at room temperature for 2 weeks. For longer periods, it should be stored at -20°C.
    Control antigen reconstitution 100 μl PBS.
    Control antigen storage after reconstitution -20°C.
    Preadsorption Control 3 µg fusion protein per 1 µg antibody.
    Standard quality control of each lot Western blot analysis.
    Applications: ic, ih, ip, wb
    May also work in: ifc
      • Western blot analysis of rat brain membranes:
        1. Anti-GIRK1 (Kir3.1) Antibody (#APC-005), (1:200).
        2. Anti-GIRK1 (Kir3.1) Antibody, preincubated with the control antigen.
      • Mouse atrial myocytes (Cui, S. et al. (2010) J. Biol. Chem. 285, 41732.).
      • Rat brain sections.

        Human skin sections (1:200) (Nockemann, D. et al. (2013) EMBO Mol. Med. 5, 1263.).
      • Kir3.1 (or G-protein regulated inward-rectifier K+ channel 1, GIRK1) is a member of the family of inward rectifying K+ channels. The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.

        The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels, the functional unit for the Kir channels is composed of four subunits that can assemble as either homo- or heterotetramers.

        Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.

        Kir3.1 is a member of the Kir3.x subfamily that includes four members (Kir3.1- Kir3.4). The Kir3 family is characterized by the fact that the channels can be activated by neurotransmitters and other factors acting via the activation of G-protein coupled receptors. Binding of the corresponding ligand to the G-protein receptor induces the dissociation of Gα-GTP from the Gβγ dimer. The latter directly binds to Kir3 and activates the channel1,3.

        In the heart, Kir3.1 co-assembles with Kir3.4 to form the prototypical muscarinic-gated K+ channel KAch current, responsible for slowing the heart rate in response of parasympathetic stimulation2.

        In the brain, Kir3.1 co-assembles with Kir3.2 and mediates the inhibitory effects of many neurotransmitters including opioid, adrenergic, muscarinic, dopaminergic and γ-aminobutyric acid (GABA)1,3.

        A peptide toxin originating from the Apis mellifera bee venom, Tertiapin (#STT-250) was shown to be a potent blocker of Kir3.1 containing channels (8.6 nM for the Kir3.1/3.4 combination and 5.4 nM for the Kir3.1/3.2)4,5.

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Image & Title:

    Anti-GIRK1 (Kir3.1) Antibody
    Expression of GIRK1 in mouse VNO neuronsImmunohistochemical staining of wild-type (left panel) and Girk1–/– (right panel) VNO neurons using Anti-GIRK1 (Kir3.1) Antibody (#APC-005).Adapted from Kim, S. et al. (2012) Nat. Neurosci. 15, 1236. with permission of Nature America.

    Last update: 04/04/2019

    Anti-GIRK1 (Kir3.1) Antibody (#APC-005) is a highly specific antibody directed against an epitope of the mouse protein. The antibody can be used in western blot, immunprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize Kir3.1 from human, rat, and mouse samples.

    For research purposes only, not for human use
    Citations
      • Immunohistochemical staining of mouse VNO neurons. Also tested in KO mice.
        Kim, S. et al. (2012) Nat. Neurosci. 15, 1236.
      • Western blot analysis of mouse brain lysates. Also tested in GIRK1-/- mice.
        Koyrakh, L. et al. (2005) J. Neurosci. 25, 11468.
      • Human heart and cardiomyocyte lysates.
        Morishima, M. et al. (2016) Circ. J. 80, 1346.
      • Mouse INS-1 cells lysates.
        Wu, Y. et al. (2015) J. Biol. Chem. 290, 29676.
      • Mouse brain lysate (1:1000).
        Goodfellow, N.M. et al. (2014) J. Neurosci. 34, 6107.
      • Rat cardiomyocytes.
        Bingen, B.O. et al. (2013) Circulation 128, 2732.
      • Mouse brain lysates. Also tested in GIRK1-/- mice.
        Koyrakh, L. et al. (2005) J. Neurosci. 25, 11468.
      • Mouse atrial myocytes.
        Cui, S. et al.(2010) J. Biol. Chem. 285, 41732.
      • Rat brain sections.
        Dell’Orco, J.M. et al. (2015) J. Neurosci. 35, 11292.
      • Mouse and Rat DRG, sciatic nerve and skin sections (1:200).
        Nockemann, D. et al. (2013) EMBO Mol. Med. 5, 1263.
      • Human skin sections (1:200).
        Nockemann, D. et al. (2013) EMBO Mol. Med. 5, 1263.
      • Rat heart sections (1:20).
        Atkinson, A.J. et al. (2013) J. Am. Heart Assoc. 2, e000246.
      • Mouse VNO neurons. Also tested in KO mice.
        Kim, S. et al. (2012) Nat. Neurosci. 15, 1236.
    Related Products