Recombinant human Neurotrophin-4 (NT-4) protein

Human Neurotrophin-4, Recombinant, E. coli
    Cat #: N-270
  • Lyophilized Powder
  • Bioassay Tested
  • Sterile & Endotoxin Free
  • Origin Recombinant, E. coli
    MW: 28.1 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Sequence MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA.
      • Recombinant human Neurotrophin-4 (NT-4) protein
    Activity NT-4 is involved in many biological outcomes including promoting dendritic outgrowth and Ca2+ currents in cultured mesencephalic dopamine neurons1, promoting growth and remodeling of adult motor neuron innervation2. The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins3.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 µg/0.1 ml.
    BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
      • Recombinant human Neurotrophin-4 (NT-4) protein
        Alomone Labs Recombinant human Neurotrophin-4 (NT-4) protein induces activation of ERK1/2 MAPK in TrkB transfected HEK-293 cells.
        Cells were serum starved for 2 h, preincubated with or without 200 nM K252a (#K-150) as indicated and then stimulated with various concentrations of Recombinant human Neurotrophin-4 (NT-4) protein (#N-270). Cell proteins were resolved by SDS-PAGE and probed with anti-phospho-ERK1/2.
    References - Scientific background
      • The neurotrophins ("neuro" means nerve and "trophe" means nutrient) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and PNS.1

        Neurotrophin-4 (NT-4) is expressed in neurons of the superior cervical, stellate and celiac ganglion,2 T-cells3 and is synthesized by keratinocytes.4

        The structural hallmark of all the neurotrophins is the characteristic arrangement of the disulfide bridges known as the cysteine knot, which has been found in other growth factors such as PDGF.5

        The rat and human forms of NT-4 are 96% homologous. NT-4 has been shown to promote dendritic outgrowth and calcium currents in cultured mesencephalic dopamine neurons,6 to promote growth and remodeling of adult motor neuron innervation,7 to be anterograde survival factors for postsynaptic cells8 and to protect against apoptotic neuronal death.9

        The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins.10

    Net Peptide Content: 100%
    Last update: 17/07/2019

    Recombinant human Neurotrophin-4 (NT-4) protein (#N-270) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use