Kaliotoxin-1

Kchannel toxin α-KTx 3.1, KTX-1
A Powerful Blocker of KCa1.1 and certain KV1 Channels
Cat #: STK-370
Alternative Name Kchannel toxin α-KTx 3.1, KTX-1
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide originated from Androctonus mauritanicus mauritanicus (Scorpion).
    MW: 4150 Da.
    Purity: >98% (HPLC)
    Effective concentration 10-100 nM.
    Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK.
    Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35. Lys38 - C-terminal amidation.
    Molecular formula C171H284N56O48S6.
    CAS No.: 145199-73-1.
    Activity Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K+ channels (KV1.1, KV1.2 and KV1.3 nM)3.
      • Crest, M. et al. (1992) J. Biol. Chem267, 1640.

      • Romi, R. et al. (1993) J. Biol. Chem. 268, 26302.

      • Mourre, C. et al. (1999) J. Pharmcol. Exp. Ther. 291, 943.

    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • Alomone Labs Kaliotoxin-1 inhibits KV1.3 channels heterologously expressed in Xenopus oocytes.
        Currents were elicited by application of voltage ramp from a holding potential of -80 mV to 50 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at 0 mV), before (black) and during (green) application of 1 nM Kaliotoxin-1 (#STK-370). B. Top, illustration of the voltage ramp protocol. Bottom, example of superimposed current traces before (black) and during (green) application of 1 nM Kaliotoxin-1, taken from the experiment in A.
      • Kaliotoxin-1 is a 38 amino acid long toxin, originally isolated from the venom of Androctonus mauretanicus mauretanicus scorpion and is classified as α-KTX 3.1 scorpion toxin family, having three disulfide bridges1,2.

        Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)3, and it also binds and inhibits Dendrotoxin-sensitive voltage-dependent K+ channels, mainly KV1.1 (KCNA1), KV1.2 (KCNA2) and KV1.3 (KCNA3) with a Kd of 1.5, 25 and 0.1 nM, respectively4-6. Its binding affinity to rat brain synaptosomes is 5-fold higher than that of Kaliotoxin-37.

        The 3D structure of Kaliotoxin was determined by NMR spectroscopy and showed significant differences from structures established for other related scorpion toxins8,9.

        In vivo application of Kaliotoxin was shown to facilitate cognitive processes such as learning in rats10.

    Target KCa1.1 and some KV1 Kchannels
    Net Peptide Content: 100%
    Last update: 30/06/2019

    Kaliotoxin-1 (#STK-370) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products