Every lot is tried & tested in a relevant biological assay.
Our Bioassay
QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG.
MitTx-β subunit:
NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ.
- Bohlen, C.J. et al. (2011) Nature 479, 410.
- Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254.
- Alomone Labs alpha/beta (1:1) MitTx activates ASIC1a channels expressed in Xenopus oocytes.Membrane potential was held at -80mV. ASIC1a channels current was elicited every 50 sec by transient pH 5.5 stimulation (arrows) or activated by a 3 min application of 50 nM alpha/beta MitTx (#M-100), as indicated.
- Bohlen, C.J. et al. (2011) Nature 479, 410.
- Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254.
alpha/beta MitTx is a natural toxin isolated from the Texas Coral snake venom1. The purified active toxin consists of a heteromeric complex between Kunitz (α subunit) and phospholipase-A2-like (β subunit) proteins that together function as a potent, persistent and selective agonist for acid-sensing ion channels (ASICs), showing equal or greater efficacy compared with acidic pH1.
MitTx-α and MitTx-β form a high affinity 1:1 complex, and neither subunit demonstrates functional effects on its own1,2.
The purified ASIC-activating component of the venom, MitTx, was found to be sufficient to elicit robust nocifensive behaviors and is likely responsible for the lasting pain experienced by victims of coral snake envenomation2.
alpha/beta MitTx (#M-100) is a highly pure, natural, and biologically active peptide toxin.
Applications
Citations
- Xenopus oocytes expressing ASIC1 (two electrode voltage clamp).
Barth, D. and Fronius, M. (2019) Sci. Rep. 9, 6781.
Specifications
Scientific Background
Related Products
Pharmacological tools
Explorer kits & Research packs
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us