Free shipping starts now, no minimum, no coupons required!

Mambalgin-3

Mamb-3

A Blocker of ASIC1a and ASIC1b Channels

Cat #: STM-500
Alternative Name Mamb-3
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 6566 Da
    Purity: >98%
    Form Lyophilized powder.
    Effective concentration 10-50 nM.
    Sequence LKCYQHGKVVTCHRDMKFCYHNIGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK.
    Modifications Disulfide bonds between Cys3-Cys19, Cys12-Cys37, Cys41-Cys49 and Cys50-Cys55.
    Structure
    Molecular formula C274H433N85O83S10.
    Activity A blocker of ASIC1-containing channels1,2.
    References-Activity
    1. Diochot, S. et al. (2012) Nature 490, 552.
    2. Baron, A. et al. (2013) Toxicon doi: 10.1016/j.toxicon.2013.04.008.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all products before use (10000 x g 5 min).
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
    Our bioassay
    • Alomone Labs Mambalgin-3 blocks Asic1a channels expressed in Xenopus oocytes.
      Alomone Labs Mambalgin-3 blocks Asic1a channels expressed in Xenopus oocytes.
      A. Representative time course of Mambalgin-3 (#STM-500) inhibition of Asic1a currents. Membrane potential was held at -80 mV, current was elicited every 50 sec by transient application of pH 5.5, and significantly inhibited by 200 nM Mambalgin-3 (top bar, green). B. Superimposed traces of Asic1a currents upon perfusion of control (black) and of 200 nM Mambalgin-3 (green), taken from the recording in A.
    References - Scientific background
    1. Baron, A. et al. (2013) Toxicon 75, 187.
    2. Kini, R.M. et al. (2010) Toxicon 56, 855.
    3. Diochot, S. et al. (2012) Nature 490, 552.
    Scientific background

    Mambalgin-3 is a peptide toxin originally isolated from the green mamba (Dendroaspis augusticeps) snake venom1. The toxin inhibits rat ASIC1a (IC50 = 17 nM), ASIC1b (IC50 = 44 nM) and heteromeric ASIC1a-ASIC2a (IC50 = 252 nM) channels1.

    Acid-sensing ion channels (ASICs) are voltage-independent proton-gated cation channels that are largely expressed in the nervous system as well as in some non-neuronal tissues. In rodents, six different isoforms (ASIC1a, 1b, 2a, 2b, 3 and 4) can associate into homo- or hetero-trimers to form a functional channel1.

    Mambalgins define a new structural and functional class among snake three-finger toxins. These type of toxins are found in snake venoms (Mambalgin1 and 2 were originally isolated from black mambas) and are characterized by their distinctive structure2. Mambalgins are the only three-finger toxins to target ASIC channels and show no neurotoxic effect. These three-finger toxins show an analgesic effect against acute and inflammatory pain upon central and peripheral injection that can be as strong as morphine. Mambalgins cause much less tolerance than morphine and no respiratory distress3.

    Target ASIC1a and ASIC1b channels
    Net Peptide Content: 100%
    Last update: 25/04/2021

    Mambalgin-3 (#STM-500) is a highly pure, synthetic, and biologically active peptide.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Shipping and Ordering information