Aam-KTX

Potassium channel toxin α-KTx 3.12, Kaliotoxin analog
A Blocker of Voltage-Gated K+ channels
Cat #: STA-110
Alternative Name Potassium channel toxin α-KTx 3.12, Kaliotoxin analog
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide originated from Androctonus amoreuxi (African fattail scorpion).
    MW: 4185 Da.
    Purity: >99% (HPLC)
    Effective concentration 0.1-1 nM.
    Sequence GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK.
    Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33and Cys18-Cys35.K38 - C-terminal amidation.
    Molecular formula C174H288N58O48S7.
    Activity Aam-KTX is a KV1.3 channel blocker1.
      • Abbas, N. et al. (2008) Biochem. Biophys. Res. Commun. 376, 525.

    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs Aam-KTX inhibits KV1.3 channel currents expressed in Xenopus oocytes.
        A. Time course of Aam-KTX (#STA-110) action on KV1.3 channels current. Peak current amplitude recorded at +55 mV was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage ramp to +60 mV. 0.5 nM Aam-KTX was perfused as indicated by the bar (green). B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 0.50 nM Aam-KTX (taken from the experiment in A).
      • Abbas, N. et al. (2008) Biochem. Biophys. Res. Commun. 376, 525.
      • Zhu, S. et al. (2011) Mol. Cell. Proteomics. 10, M110.
      • KTxs are scorpion peptide toxins that act on voltage-gated K+ channels which can be divided into four groups: α, β, γ, and κ. Aam-KTX is an analogue of Kaliotoxin that originates from Androctonus amoreuxi scorpion venom. It contains a conserved α-helix/β-sheet structural motif composed of a single α-helix and one β-sheet of two antiparallel strands. KTxs primarily affects voltage-gated Shaker-related and ether-a-go-go-related gene (ERG) K+ channels and Ca2+-activated K+ channels of high, intermediate, or small conductance1,2. IC50 values of Aam-KTX for KV1.3 channel and KV1.2 are 1.1 ± 0.02 and 10.4 ± 1.5 nM, respectively1.

        Potassium channels are a large family of membrane proteins ubiquitously distributed in excitable and nonexcitable cells. These channels play a major role in different physiological processes1.

    Target KV K+ channels
    Net Peptide Content: 100%
    Last update: 30/06/2019

    Aam-KTX (#STA-110) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use