Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

ADWX-1

ADWX1, ADWX 1
A Blocker KV1.3 K+ Channels
Cat #: STW-100
Alternative Name ADWX1, ADWX 1
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide originated from rationally designed, highly specific KV1.3 inhibitor peptide, based on the scorpion (Mesobuthus martensii) toxin BmKTX.
    MW: 4072 Da.
    Purity: >98% (HPLC)
    Effective concentration 1 pM - 2 nM.
    Sequence VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK.
    Modifications Disulfide bonds between Cys7-Cys27, Cys13-Cys32, and Cys17-Cys34.
    Molecular formula C169H281N57O46S7.
    Activity Selective potent KV1.3 blocker1-3.

      • Romi-Lebrun, R. et al. (1997) Biochemistry 36, 13473.

      • Han, S. et al.  (2008) J. Biol. Chem. 283, 19058.

      • Li, Z.  et al.  (2012) J. Biol. Chem. 287, 29479.

    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs ADWX-1 inhibits KV1.3 currents heterologously expressed in Xenopus oocytes.
        A. Time course of ADWX-1 (#STW-100) blocking action on KV1.3 currents. Membrane potential was held at -80 mV and cells were stimulated by a 100 ms voltage ramp to +40 mV. 1 nM ADWX-1 was perfused as indicated by the bar (green) at +35 mV. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 1 nM ADWX-1 (taken from the experiment in A).
      • Han, S. et al.  (2008) J. Biol. Chem. 283, 19058.
      • Li, Z.  et al.  (2012) J. Biol. Chem. 287, 29479.

      • KV1.3 channel is an attractive pharmacological target for immunomodulation of T cell-mediated autoimmune diseases. ADWX-1 peptide is a potent and selective KV1.3 channel blocker. ADWX-1 peptide is a synthetic analog of the scorpion peptide BmKTx. This peptide is based on the natural BmKTX in which three important residues were mutated in a structure-modification strategy to enhance the KV1.3 channel selectivity1. ADWX-1 inhibits KV1.3 channels heterologously expressed in HEK-293 cells. ADWX-1 blocks KV1.3 currents with an IC50 of 0.0019 nM and displays specificity for KV1.3 over KV1.1 and KV1.2 (IC50 values are 0.65 nM).

        ADWX-1 inhibits CD4+ CCR7- T-cell proliferation.

        ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of KV1.3 channel and auto-immunity pathways2.
    Target KV1.3 K+ channel
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 0.1 mg free trial sample!
    Last update: 30/06/2019

    ADWX-1 (#STW-100) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products
        •