Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

ADWX-1

ADWX1, ADWX 1

A Blocker KV1.3 K+ Channels

Cat #: STW-100
Alternative Name ADWX1, ADWX 1
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4072 Da
    Purity: >98% (HPLC)
    Effective concentration 1 pM - 2 nM.
    Sequence VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK.
    Modifications Disulfide bonds between Cys7-Cys27, Cys13-Cys32, and Cys17-Cys34.
    Structure
    Molecular formula C169H281N57O46S7.
    Activity Selective potent KV1.3 blocker1-3.
    References-Activity
    1. Romi-Lebrun, R. et al. (1997) Biochemistry 36, 13473.
    2. Han, S. et al.  (2008) J. Biol. Chem. 283, 19058.
    3. Li, Z.  et al.  (2012) J. Biol. Chem. 287, 29479.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs ADWX-1 inhibits KV1.3 currents heterologously expressed in Xenopus oocytes.
      Alomone Labs ADWX-1 inhibits KV1.3 currents heterologously expressed in Xenopus oocytes.
      A. Time course of ADWX-1 (#STW-100) blocking action on KV1.3 currents. Membrane potential was held at -80 mV and cells were stimulated by a 100 ms voltage ramp to +40 mV. 1 nM ADWX-1 was perfused as indicated by the bar (green) at +35 mV. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 1 nM ADWX-1 (taken from the experiment in A).
    References - Scientific background
    1. Han, S. et al.  (2008) J. Biol. Chem. 283, 19058.
    2. Li, Z.  et al.  (2012) J. Biol. Chem. 287, 29479.
    Scientific background

    KV1.3 channel is an attractive pharmacological target for immunomodulation of T cell-mediated autoimmune diseases. ADWX-1 peptide is a potent and selective KV1.3 channel blocker. ADWX-1 peptide is a synthetic analog of the scorpion peptide BmKTx. This peptide is based on the natural BmKTX in which three important residues were mutated in a structure-modification strategy to enhance the KV1.3 channel selectivity1. ADWX-1 inhibits KV1.3 channels heterologously expressed in HEK-293 cells. ADWX-1 blocks KV1.3 currents with an IC50 of 0.0019 nM and displays specificity for KV1.3 over KV1.1 and KV1.2 (IC50 values are 0.65 nM).

    ADWX-1 inhibits CD4+ CCR7- T-cell proliferation.

    ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of KV1.3 channel and auto-immunity pathways2.

    Target KV1.3 K+ channel
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 29/08/2021

    ADWX-1 (#STW-100) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us