Agitoxin-1

K+ channel toxin α-KTx 3.4, Leiurotoxin-2, AgTx-1, AgTx1, Leiurotoxin II, LeTx II
A Potent Blocker of KV1.3 Channels
Cat #: RTA-150
Alternative Name K+ channel toxin α-KTx 3.4, Leiurotoxin-2, AgTx-1, AgTx1, Leiurotoxin II, LeTx II
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Recombinant, E. coli originated from Leiurus quinquestriatus hebraeus (Yellow scorpion).
    MW: 4015 Da.
    Purity: >98% (HPLC)
    Effective concentration <1 nM.
    Sequence GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK.
    Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35.
    Molecular formula C169H278N52O47S7.
    CAS No.: 155646-21-2.
    Activity Agitoxin-1 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • Alomone Labs Agitoxin-1 inhibits KV1.3 channels heterologously expressed in Xenopus oocytes.
        Left: Sample current responses to 100 ms depolarization to 0 mV from holding potential of -100 mV, delivered every 10 seconds before (red) and during (black) application of 10 nM Agitoxin-1 (#RTA-150). Right: time course of amplitude inhibition. The effect of 10 and 50 nM Agitoxin-1 on KV1.3 current amplitude are shown. The horizontal bars indicate the periods of toxin perfusion.
      • Like Agitoxin-2, Agitoxin-1 is a potent blocker of the Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.1
    Target KV1.3 channels
    Net Peptide Content: 100%
    Last update: 30/06/2019

    Agitoxin-1 (#RTA-150) is a highly pure, recombinant, and biologically active peptide toxin.

    For research purposes only, not for human use