Anti-PSD-93 Antibody

Discs large homolog 2, Dlg2, Chapsyn-110
Cat #: APZ-002
Alternative Name Discs large homolog 2, Dlg2, Chapsyn-110
  • KO Validated
  • Lyophilized Powder
  • Antigen Incl.
  • Type: Polyclonal
    Source: Rabbit
    Reactivity: m, r
    May also work in: h
      • GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110 (Accession Q63622). Between PDZ2 and PDZ3 domains.
    Accession (Uniprot) Number Q63622
    Gene ID 64053
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Human - 42/44 amino acid residues identical.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
    Isotype Rabbit IgG.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 1 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Control antigen storage before reconstitution Lyophilized powder can be stored intact at room temperature for 2 weeks. For longer periods, it should be stored at -20°C.
    Control antigen reconstitution 100 μl PBS.
    Control antigen storage after reconstitution -20°C.
    Preadsorption Control 1 μg fusion protein per 1 μg antibody.
    Standard quality control of each lot Western blot analysis.
    Applications: ic, ih, ip, wb
      • Western blot analysis of rat brain membranes:
        1. Anti-PSD-93 Antibody (#APZ-002), (1:1000).
        2. Anti-PSD-93 Antibody, preincubated with the control fusion protein antigen.
      • COS7 cells and mouse brain lysate (Nada, S. et al. (2003) J. Biol. Chem. 278, 47610.).
      • Rat brain sections.
      • Chick ciliary ganglion cells (Temburni, M.K. et al. (2004) J. Neurosci. 24, 6776.).
      • Chapsyn 110 (also known as PSD-93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.

        PDZ domains are conserved protein domains of about 90 amino acids involved in protein–protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.

        MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.

        The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.

        Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2.

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Image & Title:

    Anti-PSD-93 Antibody
    Expression of PSD-93 in mouse sciatic nerve.Immunohistochemical staining of mouse sciatic nerve using Anti-PSD-93 Antibody (#APZ-002). PSD-93 staining (red) is detected in the juxtaparanode region of the Nodes of Ranvier. Shown are Na+ channel staining (green) and Caspr staining (blue) at the node and paranodes. Note the lack of staining in PSD93-/- mice.Adapted from Horresh, I. et al (2008) J. Neurosci. 28, 14213. with permission of the Society for Neuroscience.

    Last update: 12/06/2019

    Anti-PSD-93 Antibody (#APZ-002) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize PSD-93 from rat, mouse, and human samples.

    For research purposes only, not for human use
    Citations
      • Immunohistochemical staining of mouse sciatic nerve. Also tested in PSD93-/- mice.
        Horresh, I. et al (2008) J. Neurosci. 28, 14213.
      • HEK 293 transfected cells.
        Shukla, A. et al. (2017) EMBO J. 36, 458.
      • Mouse brain lysate.
        Lindquist, S. et al (2011) PLoS ONE 6, e23978.
      • Mouse cortical neuron lysate (1:1000).
        Zhang, M. et al (2010) Neuroscience 166, 1083.
      • Mouse brain lysate (1:1000).
        Liaw, W-J. et al (2008) Mol. Pain 4, 45.
      • Mouse brain lysate.
        Jarabek, B.R. et al. (2004) Brain 127, 505.
      • Chick brain lysate.
        Temburni, M.K. et al. (2004) J. Neurosci. 24, 6776.
      • COS7 cells and mouse brain lysate.
        Nada, S. et al. (2003) J. Biol. Chem. 278, 47610.
      • COS7 cells and mouse brain lysate.
        Nada, S. et al. (2003) J. Biol. Chem. 278, 47610.
      • Mouse sciatic nerve. Also tested in PSD93-/- mice.
        Horresh, I. et al (2008) J. Neurosci. 28, 14213.
      • Chick ciliary ganglion cells.
        Temburni, M.K. et al. (2004) J. Neurosci. 24, 6776.
      • Ogawa, Y. et al (2008) J. Neurosci. 28, 5731.
      • Sans, N. et al. (2000) J. Neurosci. 20, 1260.
    Related Products