Anti-SAP102 Antibody

Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG
    Cat #: APZ-003
    Alternative Name Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG
  • Lyophilized Powder
  • Antigen Incl.
  • Type: Polyclonal
    Host: Rabbit
    Reactivity: r
      • GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102 (Accession Q92796). N-terminal part.
        Anti-SAP102 Antibody
    Accession (Uniprot) Number Q92796
    Gene ID 1741
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Rat, mouse - 26/32 amino acid residues identical.
    RRID AB_2039824.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
    Isotype Rabbit IgG.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 0.8 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Negative control antigen storage before reconstitution Lyophilized powder can be stored intact at room temperature for 2 weeks. For longer periods, it should be stored at -20°C.
    Negative control antigen reconstitution 100 μl PBS.
    Negative control antigen storage after reconstitution -20°C.
    Preadsorption Control 1 μg fusion protein per 1 μg antibody.
    Standard quality control of each lot Western blot analysis.
    Applications: ih, wb
      • Anti-SAP102 Antibody
        Western blot analysis of rat brain membranes:
        1. Anti-SAP102 Antibody (#APZ-003), (1:400).
        2. Anti-SAP102 Antibody, preincubated with the control fusion protein antigen.
      • Rat brain sections.
    References
      • SAP-102 (also known as DLG3) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.

        PDZ domains are conserved protein domains of about 90 amino acids involved in protein–protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.

        MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.

        The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.

        SAP-102 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2. Moreover, mutations in the SAP102 gene have been linked with a form of mental retardation3.

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry,
    IF- Immunofluorescence, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Last update: 19/09/2019

    Alomone Labs is pleased to offer a highly specific antibody directed against an epitope located at the N-terminal region of the human SAP-102. Anti-SAP102 Antibody (#APZ-003) can be used in western blot and immunohistochemistry applications, and has been designed to recognize SAP-102 from rat, mouse and human samples.

    For research purposes only, not for human use
    Citations
    Related Products