Free shipping starts now, no minimum, no coupons required!

Hd1a Toxin

µ-TRTX-Hd1a
A Selective Blocker of NaV1.7 Channels
Cat #: STH-200
Alternative Name µ-TRTX-Hd1a
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3822 Da.
    Purity: >98% (HPLC)
    Effective concentration 500 nM - 1 µM.
    Sequence ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31.
    Structure
    Molecular formula C160H246N46O51S6.
    Activity Hd1a is a selective and potent blocker of voltage-gated NaV1.7 channels1.
    References-Activity
    1. Klint, J.K. et al. (2015) Br. J. Pharmacol. 172, 2445.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Hd1a Toxin inhibits NaV1.7 currents heterologously expressed in Xenopus oocytes.
      Alomone Labs Hd1a Toxin inhibits NaV1.7 currents heterologously expressed in Xenopus oocytes.
      A. Time course of Hd1a Toxin (#STH-200) inhibition of NaV1.7 channels current. Membrane potential was held at -90 mV and current was elicited by a 100 ms voltage step to -10 mV, delivered every 2 sec. 1 µM Hd1a Toxin applied for 9 min, as indicated by the bar (green), causes gradual and reversible inhibition of current. B. Superimposed traces of NaV1.7 channel currents upon application of control (black) and of 1 µM Hd1a Toxin (green), taken from the recording shown in A.
    References - Scientific background
    1. Klint, J.K. et al. (2015) Br. J. Pharmacol. 172, 2445.
    2. Laedermann, C.J. et al. (2015) Front. Pharmacol. 6, 263.
    Scientific background

    Hd1a Toxin, also called µ-TRTX-Hd1a, is a peptide toxin that acts as a selective and potent blocker of voltage-gated NaV1.7 channels.

    The Hd1a peptide is a member of the NaSpTx family 1 of spider venoms, originating from the Haplopelma doriae spider. The toxin inhibits human NaV1.7 by interacting with the S3b-S4 paddle motif in channel domain II. Hd1a structure contains an inhibitor cystine knot motif that is likely to confer high levels of chemical, thermal and biological stability1.

    Human NaV1.7 shows properties as an analgesic target. Loss-of-function mutations in the SNC9A gene that encodes human NaV1.7 result in congenital indifference to all forms of pain. Thus, inhibitors of hNaV1.7 including Hd1a Toxin are likely to be useful analgesics for treating a range of pain conditions1,2.

    Target NaV1.7 channel
    Net Peptide Content: 100%
    Last update: 23/08/2020

    Hd1a Toxin (#STH-200) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources