Free shipping starts now, no minimum, no coupons required!

Jingzhaotoxin XI

JzTx-XI, κ-Theraphotoxin-Cg1a 1, κ-TRTX-Cg1a, Jingzhaotoxin-11, JZTX-11, Jingzhaotoxin-XI, JZTX-XI

A Blocker of NaV1.5 and KV2.1 Channels

Cat #: STJ-400
Alternative Name JzTx-XI, κ-Theraphotoxin-Cg1a 1, κ-TRTX-Cg1a, Jingzhaotoxin-11, JZTX-11, Jingzhaotoxin-XI, JZTX-XI
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3726 Da
    Purity: 98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 0.5-1 µM.
    Sequence ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF.
    Modifications Disulfide bonds between Cys2- Cys16, Cys9- Cys21, Cys15- Cys28. C-terminal amidation at Phe34.
    Structure
    Molecular formula C158H234N44O47S7.
    Activity Jingzhaotoxin XI is a blocker of voltage-gated Na+ channel NaV1.5 with an IC50 value of 124 ± 26 nM and voltage-gated K+ channel KV2.1 with an IC50 value of 390 ± 60 nM1.
    References-Activity
    1. Tao, H. et al. (2016) Toxicon 124, 8.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g for 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Jingzhaotoxin XI blocks KV2.1 channels expressed in Xenopus oocytes.
      Alomone Labs Jingzhaotoxin XI blocks KV2.1 channels expressed in Xenopus oocytes.
      A. Representative time course of Jingzhaotoxin XI (#STJ-400) inhibition of KV2.1 current. Membrane potential was held at -80 mV, current was elicited by a 300 ms voltage step to +10 mV every 10 sec, and inhibited by 0.1 µM and 1 µM Jingzhaotoxin XI, applied as indicated by horizontal bars. B. Superimposed traces of KV2.1 current after the application of control, 0.1 µM and 1 µM Jingzhaotoxin XI (taken from experiment in A).
    • Alomone Labs Jingzhaotoxin XI blocks NaV1.5 channels expressed in Xenopus oocytes.
      Alomone Labs Jingzhaotoxin XI blocks NaV1.5 channels expressed in Xenopus oocytes.
      A. Representative time course of Jingzhaotoxin XI (#STJ-400) inhibition of NaV1.5 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +40 mV every 10 sec, and inhibited significantly by 1 µM Jingzhaotoxin XI. B. Superimposed traces of NaV1.5 current following the application of control and of 1 µM Jingzhaotoxin XI (taken from experiment in A).
    References - Scientific background
    1. Tao, H. et al. (2016) Toxicon 124, 8.
    2. Liao, Z. et al. (2006) Biochemistry 45, 15591.
    3. Tang, C. et al. (2014) Toxicon 92, 6.
    4. Liu, X. et al. (2017) Oncotarget 8, 59345.
    5. Wang, J. et al. (2017) Mol. Med. Rep. 16, 719.
    Scientific background

    Jingzhaotoxin XI (JzTx-XI) is a 34-residue peptide toxin originally isolated from the Chinese tarantula Chilobrachys jingzhao venom. Jingzhaotoxin XI toxin can potently inhibit both voltage-gated Na+ channel NaV1.5 with an IC50 value of 124 ± 26 nM and voltage-gated K+ channel KV2.1 with an IC50 value of 390 ± 60 nM1,2,3.

    The mature toxin contains six cysteine residues linked through disulfide bridges and a hydrophobic patch surrounded by charged residues such as Arg or Lys. Jingzhaotoxin XI is a useful tool for investigating the promiscuity of spider toxins2.

    KV2.1 channels play an important role in neuronal systems including the neural retina. The channel’s functions include regulation of neuronal excitability and neural transmitter release4.

    NaV1.5 channels are important in generating and propagating action potentials in excitable cells, in working myocardium and cardiac tissue conduction cells5.

    Target KV2.1 and NaV1.5 channels
    Net Peptide Content: 100%
    Last update: 11/04/2021

    Jingzhaotoxin XI (#STJ-400) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information