Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Jingzhaotoxin-IX

Jingzhaotoxin-9, JzTx-9, JzTx-IX, Peptide F6-16.24

A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels

Cat #: STJ-300
Alternative Name Jingzhaotoxin-9, JzTx-9, JzTx-IX, Peptide F6-16.24
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3953 Da
    Purity: >98% (HPLC)
    Effective concentration 0.5-1 µM.
    Sequence ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF.
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys29. Phe35 – C-terminal amidation.
    Structure
    Molecular formula C171H251N49O48S6.
    Activity Jingzhaotoxin-IX blocks NaV1.4, NaV1.5 and KV2.1 voltage-gated channels1.
    References-Activity
    1. Deng, M. et al. (2009) Neuropharmacology 57, 77.
    Accession number P0CH44.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Jingzhaotoxin-IX blocks NaV1.5 channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Jingzhaotoxin-IX blocks NaV1.5 channels heterologously expressed in Xenopus oocytes.
      A. Time course of Jingzhaotoxin-IX (#STJ-300) action on NaV1.5 currents. Peak current amplitude at -20 mV was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 50 ms voltage step to -20 mV. 1 µM Jingzhaotoxin-IX (applied for 4.5 min, green) was perfused during the period marked by the bar. B. Superimposed traces of channel current in the absence (black) and presence (green) of 1 µM Jingzhaotoxin-IX (taken from experiment in A).
    References - Scientific background
    1. Deng, M. et al. (2009) Neuropharmacology 57, 77.
    Scientific background

    Jingzhaotoxin-IX (JZTX-IX) is a neurotoxin, C-terminally amidated peptide composed of 35 amino acid residues. JZTX-IX was originally purified from the venom of the tarantula Chilobrachys jingzhao, one of the most venomous spiders in China.

    Jingzhaotoxin-IX interacts with several types of ion channels, such as NaV channels, tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms and KV2.1 channels.

    Binding of JZTX-IX toxin to the ion channel can shift the voltage dependence of channel activation to a more positive voltage and is not reversible by extreme depolarization. 10 μM of the toxin is sufficient for a total blockade of the ion channels at resting point without pulsing.

    Target NaV1.4, NaV1.5, KV2.1 channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 06/11/2022

    Jingzhaotoxin-IX (#STJ-300) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us