Phlo1b

Mu-theraphotoxin-Phlo1b, Mu-TRTX-Phlo1b
A Blocker of NaV1.7 Channels
    Cat #: STP-370
    Alternative Name Mu-theraphotoxin-Phlo1b, Mu-TRTX-Phlo1b
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4140 Da.
    Purity: >98% (HPLC)
    Effective concentration 100 nM - 1 µM.
    Sequence ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTF.
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys29 (by homology). Phe35 – C-terminal amidation.
      • Phlo1b
    Molecular formula C181H260N52O49S6.
    Activity Phlo1b is a specific NaV1.7 channel blocker1.
    Shipping and storage Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Phlo1b
        Alomone Labs Phlo1b inhibits NaV1.7 channels expressed in Xenopus oocytes.
        A. Time course of Phlo1b (#STP-370) inhibition of NaV1.7 channel currents. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to -10 mV delivered every 10 sec, and was significantly inhibited by a 3 min application of 200 nM Phlo1b (green bar). B. Superimposed traces of NaV1.7 channel currents upon application of control (black) and of 200 nM Phlo1b (green), taken from the recording shown in A.
    References - Scientific background
    • 1. Chow, C.Y. et al. (2015) Toxins 7, 2494.
    • 2. Klint J.K. et al. (2015) Br. J. Pharmacol. 172, 2445.
      • Phlo1b is a NaV1.7 channels blocker, originally isolated from the venom of the Australian Phlogius sp. Tarantula. The peptide toxin is a gating modifier that inhibits NaV1.7 activation through its interaction with one or more voltage-sensor domains and displays an IC50 value of 0.36 µM1.

        Phlo1b is a 35-residue peptide that belongs to the NaSpTx2 family and is a valuable research tool and lead molecule for the development of ion channel therapeutics. NaSpTx2 family peptides contain three disulfide bonds and they share highly stable inhibitor cystine knot (ICK) fold that provides resistance to chemical and thermal degradation1.

        There are nine mammalian subtypes of voltage-gated NaV channels: They are responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as cardiac arrhythmia, and epilepsy. NaV1.7 channel plays an important role in the human pain signaling pathway and it is an important therapeutic target for treatment of chronic pain1,2.

    Target NaV1.7 channels
    Net Peptide Content: 100%
    Last update: 24/01/2020

    Phlo1b (#STP-370) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use