Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Tityustoxin-Kα

K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9
A KV1.2 Channel Blocker
    Cat #: STT-360
    Alternative Name K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3942 Da.
    Purity: >99% (HPLC)
    Effective concentration 0.5 - 50 nM.
    Sequence VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP.
    Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35.
      • Tityustoxin-Kα
    Molecular formula C168H275N49O46S7.
    CAS No.: 39465-37-7.
    Activity Tityustoxin-Kα blocks cloned KV1.2 with high potency1.
    Accession number P46114.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Tityustoxin-Kα
        Alomone Labs Tityustoxin-Kα inhibits KV1.2 currents in Xenopus oocytes.
        A. Time course of Tityustoxin-Kα (#STT-360) action on KV1.2 currents. Plateau current amplitudes were plotted as a function of time. Membrane potential was held at –100 mV and oocytes were stimulated by a 100 ms voltage step to +20 mV. 1 nM Tityustoxin-Kα was perfused as indicated by the bar (green). B. Superimposed examples of KV1.2 channel current in the absence (control) and presence of 1 nM Tityustoxin-Kα (taken from the experiment in A).
    References - Scientific background
    • 1. Werkman, T.R. et al. (1993) Mol. Pharmacol. 44, 430.
    • 2. Rogowski, R. S. et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 1475.
      • Tityustoxin-Kα was originally isolated from the scorpion Tityus serrulatus, and was shown to block cloned KV1.2 with high potency.1 It inhibits stably expressed KV1.2 channels in fibroblast cell line as assessed by patch clamp with Kd of 0.21 nM1. Tityustoxin-Kα also reduced the binding of 125I-α-Dendrotoxin to synaptosomal membranes2.
    Target KV1.2 K+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 0.1 mg free trial sample!
    Last update: 20/08/2019

    Tityustoxin-Kα (#STT-360) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products