Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Aam-KTX

Potassium channel toxin α-KTx 3.12, Kaliotoxin analog

A Blocker of Voltage-Gated K+ channels

Cat #: STA-110
Alternative Name Potassium channel toxin α-KTx 3.12, Kaliotoxin analog
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4185 Da
    Purity: >99% (HPLC)
    Effective concentration 0.1-1 nM.
    Sequence GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK.
    Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33and Cys18-Cys35.K38 - C-terminal amidation.
    Structure
    Molecular formula C174H288N58O48S7.
    Activity Aam-KTX is a KV1.3 channel blocker1.
    References-Activity
    1. Abbas, N. et al. (2008) Biochem. Biophys. Res. Commun. 376, 525.
    Accession number P0C8R1.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Aam-KTX inhibits KV1.3 channel currents expressed in Xenopus oocytes.
      Alomone Labs Aam-KTX inhibits KV1.3 channel currents expressed in Xenopus oocytes.
      A. Time course of Aam-KTX (#STA-110) action on KV1.3 channels current. Peak current amplitude recorded at +55 mV was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage ramp to +60 mV. 0.5 nM Aam-KTX was perfused as indicated by the bar (green). B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 0.50 nM Aam-KTX (taken from the experiment in A).
    References - Scientific background
    1. Abbas, N. et al. (2008) Biochem. Biophys. Res. Commun. 376, 525.
    2. Zhu, S. et al. (2011) Mol. Cell. Proteomics. 10, M110.
    Scientific background

    KTxs are scorpion peptide toxins that act on voltage-gated K+ channels which can be divided into four groups: α, β, γ, and κ. Aam-KTX is an analogue of Kaliotoxin that originates from Androctonus amoreuxi scorpion venom. It contains a conserved α-helix/β-sheet structural motif composed of a single α-helix and one β-sheet of two antiparallel strands. KTxs primarily affects voltage-gated Shaker-related and ether-a-go-go-related gene (ERG) K+ channels and Ca2+-activated K+ channels of high, intermediate, or small conductance1,2. IC50 values of Aam-KTX for KV1.3 channel and KV1.2 are 1.1 ± 0.02 and 10.4 ± 1.5 nM, respectively1.

    Potassium channels are a large family of membrane proteins ubiquitously distributed in excitable and nonexcitable cells. These channels play a major role in different physiological processes1.

    Target KV K+ channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 02/01/2022

    Aam-KTX (#STA-110) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us