Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

GpTx-1

β/ω-TRTX-Gr2a, Toxin GTx1-15, Beta/omega-theraphotoxin-Gr2a

A Blocker of NaV1.7, NaV1.5 and NaV1.4 Na+ Channels

Back to product page SDS

Overview

Cat #: STG-400
Alternative Name β/ω-TRTX-Gr2a, Toxin GTx1-15, Beta/omega-theraphotoxin-Gr2a
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4073.9 Da
Purity: >98% (HPLC)
Effective concentration 10-200 nM.
Sequence DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF.
Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30.  Phe34 – C-terminal amidation.
Structure
Molecular formula C176H271N53O45S7.
Activity GpTx-1 is a NaV1.7, NaV1.5 and NaV1.4 Na+ channel blocker1,2.
References-Activity
  1. Murray, J.K. et al. (2015) J. Med. Chem. 58, 2299.
  2. Murray, J.K. et al. (2015) Bioorg. Med. Chem. Lett. 25, 4866.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs GpTx-1 inhibits NaV1.7 channels expressed in Xenopus oocytes.
    Alomone Labs GpTx-1 inhibits NaV1.7 channels expressed in Xenopus oocytes.
    A. Time course of GpTx-1 (#STG-400) inhibition of NaV1.7 channels current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and inhibited by 200 nM GpTx-1 (bar), applied for 10 min. B. Superimposed traces of NaV1.7 channel currents upon application of control and of 200 nM GpTx-1 (as indicated), taken from the recording shown in A.
Scientific background

GpTx-1 is a 34-residue peptide with inhibitory cystine knot motif and contains 3 important residues near the C-terminus that are critical for potently blocking NaV1.7 channel, with IC50 value of 10 nM. The peptide toxin was originally isolated from the Grammostola porteri spider venom1,2. In addition, GpTx-1 demonstrates selectivity against other NaV subtypes including NaV1.4 and NaV1.5 channels.

There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1–NaV1.9. These channels responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as cardiac arrhythmia, and epilepsy. NaV1.7 channel plays an important role in human pain signalling pathway and it is an important therapeutic target for treatment of chronic pain3,4.

Target NaV1.7, NaV1.5, NaV1.4 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 16/07/2023

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Anti-NaV1.7 (SCN9A) Antibody (#ASC-008)
  2. Anti-NaV1.7 (SCN9A) (extracellular) Antibody (#ASC-027)
  3. Guinea pig Anti-NaV1.7 (SCN9A) Antibody (#ASC-008-GP (formerly AGP-057))
  4. ProTx-III (#STP-150)
  5. XEN907 (#X-105)
  6. N-Me-aminopyrimidinone 9 (#N-310)
  7. PF-04856264 (#P-265)
  8. Pyrrolopyrimidine 48 (#P-275)
  9. NaV1.7 Channel Basic Research Pack (#ESB-001)
  10. NaV1.7 Channel Premium Research Pack (#ESP-001)
  11. NaV1.7 Channel Deluxe Research Pack (#ESD-001)
  12. Anti-SCN4A (NaV1.4) Antibody (#ASC-020)
  13. Anti-NaV1.5 (SCN5A) (493-511) Antibody (#ASC-005)
  14. Anti-NaV1.5 (SCN5A) (1978-2016) Antibody (#ASC-013)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

© 2023 Alomone Labs. All Rights Reserved.

Terms of Service Privacy Policy
Scroll to top

Bulk / Customized order