Certificate of Analysis

Shaker (KV1) Channel Antibody Explorer Kit

A Screening Package of Shaker (KV1) Channel Antibodies Economically Priced
Cat #: AK-219 32 Vials

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.1 (KCNA1) Antibody Cat #: APC-009

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: H, M, R
CTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1 (Accession P16388), (MW: 36 kDa.). Intracellular, C-terminus.
Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical.

Anti-KV1.1 (KCNA1) (extracellular) Antibody Cat #: APC-161

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IFC, LCI, WB Reactivity: H, M, R
Peptide (C)KDDKDFTGTIHRID, corresponding to amino acid residues 193-206 of rat KV1.1 (Accession P10499). 1st  extracellular loop.
Mouse - identical; human - 13/14 amino acid residues identical.

Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, WB Reactivity: H, M, R
GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Mouse, dog, human, - identical.

Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, LCI, WB Reactivity: M, R
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Mouse - identical; human - 12/13 amino acid residues identical.

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: H, M, R
GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Rat, rabbit, mouse - identical.

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Rat, mouse - 12/14 amino acid residues identical.

Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: AGP-005

Size: 50 µl Source: Guinea pig Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). 1st extracellular loop.
Rat, mouse - 12/14 amino acid residues identical.

Anti-KV1.4 Antibody Cat #: APC-007

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, WB Reactivity: H, M, R
KCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.

Anti-KV1.4 (extracellular) Antibody Cat #: APC-167

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, LCI, WB Reactivity: M, R
Peptide (C)GHSRLLNDTSAPHLE, corresponding to amino acid residues 348 - 362 of rat KV1.4 (Accession P15385). 1st extracellular loop.
Mouse – identical; human – 13/15 amino acid residues identical.

Anti-KV1.5 (KCNA5) Antibody Cat #: APC-004

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: H, M, R
GST fusion protein with sequence HRETDHEEQAALKEEQGIQRRESGLDTGGQRKVSCSKASFHKTGGPLEST DSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTS RETDL, corresponding to amino acid residues 513-602 of mouse KV1.5 (Accession Q61762), (MW: 37 kDa.). Intracellular, C-terminus.
Rat - 86/90 amino acid residues identical; rabbit - 71/90 amino acid residues identical; human - 70/90 amino acid residues identical; bovine, dog - 66/90 amino acid residues identical.

Anti-KV1.5 (KCNA5) (extracellular) Antibody Cat #: APC-150

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IFC, IH, WB Reactivity: H, R
Peptide (C)DERELLRHPPVP(K), corresponding to amino acid residues 268-279 of rat KV1.5 (Accession P19024). 1st extracellular loop.
Rat - 12/13 amino acid residues identical; human - 11/13 amino acid residues identical; mouse - 9/13 amino acid residues identical.

Anti-KV1.6 (KCNA6) Antibody Cat #: APC-003

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, WB Reactivity: H, M, R
RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat KV1.6 (Accession P17659), (MW: 35 kDa.). Intracellular, C-terminus.
Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical.

Anti-KV1.7 (KCNA7) Antibody Cat #: APC-063

Size: 50 µl Source: Rabbit Type: Polyclonal Application: WB Reactivity: M
Peptide TTRKAQEIHGKAPG(C), corresponding to amino acid residues 2-15 of mouse KV1.7 (Accession Q17ST2). Intracellular, N-terminus.

Anti-KV1.8 Antibody Cat #: APC-157

Size: 50 µl Source: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Peptide (C)KDPETLLPTNDIHR, corresponding to amino acid residues 187-200 of human KV1.8 (Accession Q16322). Intracellular, N-terminus.
Rat, mouse  - 13/14 amino acid residues identical.

Anti-KVβ1 Antibody Cat #: APC-127

Size: 50 µl Source: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Peptide (C)TPQHHISLKESTAK, corresponding to amino acid residues 54-67 of rat KCNAB1 (Accession P63144). N-terminus.
Mouse, human - identical.

Anti-KVβ2 Antibody Cat #: APC-117

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, WB Reactivity: H, M, R
Peptide SPGMIYSTRYGSPKR(C), corresponding to amino acid residues 20-34 of rat KCNAB2 (Accession P62483). N-terminal part.
Mouse, human, rabbit - identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

A Guinea pig polyclonal antibody (#AGP-005) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.