Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

ShK (Stichodactyla Toxin)

K+ channel toxin ShK, Toxin κ-stichotoxin-She3a, κ-SHTX-She3a
A Blocker of KV Channels
    Cat #: STS-400
    Alternative Name K+ channel toxin ShK, Toxin κ-stichotoxin-She3a, κ-SHTX-She3a
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4055 Da.
    Purity: >98% (HPLC)
    Effective concentration 1-100 nM.
    Sequence RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC.
    Modifications Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32.
      • ShK (Stichodactyla Toxin)
    Molecular formula C169H274N54O48S7.
    CAS No.: 172450-46-3.
    Activity Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.
    Accession number P29187.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
      • ShK (Stichodactyla Toxin)
        Alomone Labs ShK (Stichodactyla Toxin) inhibits KV1.3 channels heterologously expressed in Xenopus oocytes.
        A. Time course of ShK (Stichodactyla Toxin) (#STS-400) action on KV1.3 currents. Current amplitude at +35 mV was plotted as a function of time. Membrane potential was held at -80 mV and cells were stimulated by a 100 ms voltage ramp to +40 mV. 0.1 nM for 240 sec (green) and 1 nM for 120 sec (red) Stichodactyla toxin were perfused as indicated by the bars. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence of 0.1 nM (green) and 1 nM (red) Stichodactyla Toxin (taken from the experiment in A).
    References - Scientific background

      • ShK (Stichodactyla Toxin) is a peptidyl toxin originally isolated from the nematocyst of the sea anemone Stichodactyla helianthus.1

        ShK blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. It has been shown to block KV current in DRG neurons, to displace radioactive Dendrotoxin from brain synaptosomes1 and inhibit I125-Charybdotoxin binding to Jurkat T lymphocytes with an IC50 of 32 pM.2,4

        Evidence also suggests that native KV currents in the central nervous system, which are predominantly carried by KV1.2 channels, are highly sensitive to this toxin.5

        A fluorescently labeled synthetic ShK is used to recognize and to sort KV1.3 containing lymphocytes.4,6

    Target Various KV K+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 0.1 mg free trial sample!
    Last update: 13/11/2019

    ShK (Stichodactyla Toxin) (#STS-400) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products