Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Citations Search Tool
    • column
      • Blog
      • Articles
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Blockers

Certificate of Analysis

ω-Agatoxin IVA

ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A

A Blocker of P/Q-Type CaV Channels

Cat #: STA-500
Alternative Name ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A
Lyophilized Powder yes
  • Bioassay Tested

    Every lot is tried & tested in a relevant biological assay.
    Our Bioassay

  • Origin Synthetic peptide
    MW: 5202 Da
    Purity: >98% (HPLC)
    Effective concentration 20 nM - 1 µM.
    Sequence KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA.
    Modifications Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34.
    Structure
    Molecular formula C217H360N68O60S10.
    CAS No.: 145017-83-0
    Activity ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
    References-Activity
    1. Mintz, I. et al. (1992) Nature 355, 827.
    2. Meir, A. et al. (1999) Physiol. Rev. 79, 1019.
    3. Stephens, G.J. et al. (2001) Eur. J. Neurosci. 13, 1902.
    Accession number P30288.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs ω-Agatoxin-IVA inhibits CaV2.1 currents heterologously expressed in Xenopus oocytes.
      Alomone Labs ω-Agatoxin-IVA inhibits CaV2.1 currents heterologously expressed in Xenopus oocytes.
      A. Time course of ω-Agatoxin IVA (#STA-500) action on CaV2.1 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 100 ms voltage ramp to +40 mV. 500 nM ω-Agatoxin IVA were perfused as indicated by the bar (green) during 200 sec application. B. Superimposed examples of CaV2.1 channel current in the absence (control) and presence (green) of 500 nM ω-Agatoxin-IVA (taken from the experiment in A).
    • Alomone Labs ω-Agatoxin IVA potently inhibits CaV2.1 channel currents expressed in HEK 293 cells.
      Alomone Labs ω-Agatoxin IVA potently inhibits CaV2.1 channel currents expressed in HEK 293 cells.
      CaV2.1 currents were elicited by 40 ms voltage ramp from a holding potential of -100 mV to +60 mV, applied every 10 sec using whole-cell voltage clamp technique. Left: Superimposed traces of CaV2.1 currents under control conditions (black) and following 2 min perfusion with Alomone Labs 200 nM ω-Agatoxin IVA (red). Right: Time course of CaV2.1 peak current amplitude change as a result of the application of 200 nM ω-Agatoxin IVA (duration of perfusion indicated by horizontal bar).
    Scientific background

    Native ω-Agatoxin IVA (ω-Aga-IVA) was originally isolated from Agelenopsis aperta spider venom, and was shown to be a selective blocker of CaV2.1 (P/Q type) channels1. However, the sensitivity depends on the auxiliary b subunit isoform2 and on the splice variant3. Therefore, the effective concentration varies between systems. In accordance, the toxin blocks presynaptic Ca2+ currents and synaptic transmission in a variety of synapses4,5.

    ω-Agatoxin IVA is widely used in electrophysiological measurements of cloned and native channels6,7. It is used to assess the role of CaV2.1 channels in synaptic transmission4. In addition, it was used to map the spatial distribution of CaV2.1 channels in mouse cerebellar and hippocampal brain slices8.

    Target P-type Ca2+ channels
    Peptide Content: 100%
    Lyophilized Powder
    Back to product pageSDSNew Generate a Quote
    Image & Title ω-Agatoxin IVA
    Alomone Labs ω-Agatoxin IVA blocks CaV2.1 channel in mouse calyx of Held.Calyxes were whole-cell voltage-clamped at -80 mV. Traces were recorded in the presence of 1 mM CaCl2, pharmacological isolation of VGCC subtypes was performed in 2 mM CaCl2. 200 nM ω-Agatoxin IVA (#STA-500) was applied to selectively block CaV2.1.Adapted from Lubbert, M. et al. (2017) eLife 6, e28412. with permission of eLife Sciences.
    Last update: 10/01/2023

    See Related Products

    For research purposes only, not for human use

    Specifications

    Citations

    Citations

    Applications

    Scientific Background

    Shipping and Ordering information
      Back to product pageSDSNew Generate a Quote

      Resources

      • Regulatory Aspects of mGluRs
      • Voltage-Gated Ca2+ Channels in the Cardiovascular System
      • P/Q-Type (CaV2.1) Channels

      Free International Shipping

      Products are lyophilized and ship at room temperature - FREE OF CHARGE.

      We ship worldwide within 24 hours of our next business day.

      For more country-specific shipping and contact information see Ordering & Shipping.


      Free Sample Program

      Not sure whether the product fits your experimental setup?

      Try it first!


      Alomone Guarantee

      We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

      Alomone Guarantee information

      Resources

      • Regulatory Aspects of mGluRs

      • Voltage-Gated Ca2+ Channels in the Cardiovascular System

      • P/Q-Type (CaV2.1) Channels

      Need Help With This Product?

      Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

      Call us at
      +972 2587 2202 or Email Us

      Contact Us

      © 2023 Alomone Labs. All Rights Reserved.

      Terms of Service Privacy Policy
      Scroll to top

      Bulk / Customized order