Free shipping starts now, no minimum, no coupons required!

Cd1a Toxin

Beta-theraphotoxin-Cd1a, β-theraphotoxin-Cd1a, β-TRTX-Cd1a

Potent blocker of Nav1.7 channel and modest blocker of Cav2.2

Cat #: STC-260
Alternative Name Beta-theraphotoxin-Cd1a, β-theraphotoxin-Cd1a, β-TRTX-Cd1a
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Ceratogyrus darlingi (Rear horned baboon tarantula)
    Source Synthetic
    MW: 4031 Da
    Purity: >95%.
    Form Lyophilized powder.
    Effective concentration 100 - 500 nM (Nav 1.7)
    Sequence DCLGWFKSCDPKNDKCCKNYSCSRRDRWCKYDL-NH2
    Modifications Disulfide bonds between: Cys2-Cys17, Cys9-Cys22 and Cys16-Cys29
    Leu33 - C-terminal amidation
    Structure
    Molecular formula C171H253N51O51S6
    Activity Cd1a is a potent blocker of Nav1.7 channels and has a modest activity on CaV2.2 channels1.
    References-Activity
    1. Sousa, S.R. et al. (2019) PlosONE 12(9), e0182848.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in DDW.
    Centrifuge all products before use (10000 x g 5 min).
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
    Our bioassay
    • Alomone Labs Cd1a Toxin inhibits NaV1.7 channel currents heterologously expressed in Xenopus oocytes.
      Alomone Labs Cd1a Toxin inhibits NaV1.7 channel currents heterologously expressed in Xenopus oocytes.
      A. Representative time course of Cd1a Toxin (#STC-260) inhibition of NaV1.7 channels current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and significantly inhibited by application of 200 nM Cd1a Toxin (green).
      B. Superimposed traces of NaV1.7 channel current in the absence (black) and presence (green) of 200 nM Cd1a Toxin (taken from the recording in A).
    References - Scientific background
    1. Sousa, S.R. et al. (2019) PlosONE 12(9), e0182848.
    Scientific background

    Cd1a Toxin (β-theraphotoxin-Cd1a) is a spider toxin, isolated from the venom of the African rear-horned baboon tarantula Ceratogyrus darlingi, a spider species that is mostly native to southern Africa1.

    Cd1a Toxin was shown to be a potent blocker of Nav1.7 channel and has a modest activity on CaV2.2 channels. Cd1a Toxin reversed spontaneous pain behaviours induced in mice by activation of NaV1.7, demonstrating its analgesic potential1. Physiological and pharmacological studies have demonstrated that Cav channels, including CaV2.2 and a number of NaV channels, including NaV1.7, are involved in nociceptive signaling, playing a critical role in the development of chronic pain associated with tissue and nerve injury1.

    Cd1a Toxin belongs to NaSpTx family 1, a class of promiscuous toxins that can modulate a range of ion channels, including NaV, CaV, KV, mechanosensitive and proton-gated ion channels. The primary structure of Cd1a strongly suggests that it will fold into an ICK motif that is expected to provide a high level of chemical, thermal and biological stability1.

    Target Nav1.7 and Cav2.2 blocker
    Net Peptide Content: 100%

    Widget not in any sidebars
    Last update: 02/03/2021

    Cd1a Toxin (#STC-260) is a highly pure, synthetic and biologically active toxin.

    For research purposes only, not for human use
    Shipping and Ordering information