Free shipping starts now, no minimum, no coupons required!

Anti-KV1.6 (KCNA6) Antibody

Potassium voltage-gated channel subfamily A member 6, RCK2, Human brain potassium channel 2, HBK2

Cat #: APC-003
Alternative Name Potassium voltage-gated channel subfamily A member 6, RCK2, Human brain potassium channel 2, HBK2
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
  • GST fusion protein with the sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat KV1.6 (Accession P17659). Intracellular, C-terminus.
Accession (Uniprot) Number P17659
Gene ID 64358
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical.
RRID AB_2040158.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.3 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, wb
May also work in: ifc*, ip*
Western blot
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-KV1.6 (KCNA6) Antibody (#APC-003), (1:200).
    2. Anti-KV1.6 (KCNA6) Antibody, preincubated with Kv1.6/KCNA6 Blocking Peptide (#BLP-PC003).
  • Rat brain sections (see also 1,2 in publications using this product). Mouse cerebellum (1:350) (Kleopa, K.A. et al. (2006) Brai129, 1570.).
  • HeLa transfected cells (1:200) (Kleopa, K.A. et al. (2006) Brai129, 1570.).
  1. Grupe, A. et al. (1990) EMBO J. 9, 1749.
  2. Gutman, G.A. et al. (2005) Pharmacol. Rev. 57, 473.
  3. Bogin, O. (2006) Modulator 21, 28.
Scientific background

KV1.6 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.6 was first cloned from human brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.6 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2

The channel is expressed in neurons and other supporting cells in the brain, in cardiac and smooth muscle tissue as well as in ovary and testis2 and its activity influences the membrane potential and excitability of expressing cells.

KV1.6 channels are sensitive to low doses of TEA (7 mM) and high doses of 4-AP (1.5 mM), the “classical” non-selective potassium channel blockers.

Several toxins from snakes, scorpions and sea anemones venoms are potent blockers (affecting the channels in the nanomolar range) of KV1.6 channels. Among these the most potent and selective are α-Dendrotoxin ((9-25 nM) and δ-Dendrotoxin (23 nM), Agitoxin-2 (0.036 nM), Hongotoxin-1 (6 nM), Margatoxin (5 nM) and Stichodactyla Toxin (0.16 nM).3

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Last update: 08/06/2022

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of the rat KV1.6 channel. Anti-KV1.6 (KCNA6) Antibody (#APC-003) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize KV1.6 from human, rat and mouse samples.

For research purposes only, not for human use



Immunohistochemistry citations
  1. Mouse brain sections (1:400).
    Blosa, M. et al. (2015) J. Physiol. 593, 4341.
  2. Human artery tissues (1:50).
    Gojkovic-Bukarica, L. et al. (2011) Eur. J. Pharmacol. 654, 266.
More product citations
  1. Hao, J. et al. (2013) Neuron 77, 899.
  2. Kleopa, K.A. et al. (2006) Brain 129, 1570.
  3. Chittajallu, R. et. al. (2002) PNAS 99, 2350.
  4. Chung, Y.H. et al. (2000) Brain Res. 875, 164.
  5. Smart, S.L. et al. (1997) Glia 20, 127.


Scientific Background

Shipping and Ordering information