Overview
Cat #:
B-450
Alternative Name DeltaKappa-actitoxin-Avd4b, Blood depressing substance II, Blood depressing substance 2
Lyophilized Powder yes
Origin Natural peptide isolated from Anemonia sulcata (Mediterranean snakelocks sea anemone).
MW: 4776 Da
Purity: >95% (HPLC)
Effective concentration 100 nM - 5 µM.
Sequence AAPCFCPGKPDRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH.
Modifications Disulfide bonds between Cys4-Cys39, Cys6-Cys32, and Cys22-Cys40.
Structure
Molecular formula C214H307N57O57S6.
Activity BDS-II blocks the KV3.4 current. The blocking effect is rapid, direct and reversible1. BDS-II also modulates voltage-gated Na+ channels (in-house data).
References-Activity
- Diochot, S. et al. (1998) J. Biol. Chem. 273, 6744.
Accession number P59084.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
BDS-II inhibits KV3.4 channels heterologously expressed in Xenopus oocytes.Left: Example traces before (red) and during (black) bath perfusion of 1 µM BDS-II (#B-450). Holding potential was -100 mV, test potential to 0 mV (100 ms) was delivered every 10 seconds. Recordings were made while perfusing ND 96 Buffer. Right: Time course for the experiment shown on the left. The vertical bar indicates the period of BDS-II perfusion.
Alomone Labs BDS-II inhibits NaV1.7 channels stably expressed in HEK 293 cells.A. Time course of BDS-II (#B-450) action on NaV1.7 currents. Current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 20 ms voltage step to -20 mV. 100 nM BDS-II was perfused as indicated by the bar (green) for 80 sec. B. Superimposed examples of NaV1.7 channel current in the absence (control) and presence of 100 nM BDS-II (taken from the experiment in A).
Scientific background
BDS-II is a 43 amino acid peptidyl toxin isolated from the sea anemone Anemonia sulcata venom. BDS-II was shown to be a specific KV3.4 blocker. BDS-II blocked 70% of the KV3.4 current in COS-transfected cells at a concentration of 2.8 µM. The blocking effect was rapid, direct and reversible1. Recently it was shown that BDS-II blocks other KV3 channels with similar potencies.2
The closely related BDS-I was shown to modulate voltage-gated Na+ channels. It enhanced TTX-sensitive Na+ channels (highly effective on NaV1.7 channels), and weakly inhibited TTX-resistant NaV channels3. As such, we showed that BDS-II also potently inhibits NaV1.7 channels (see Our Bioassay).
Target KV3 K+ channels, NaV Na+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 10/04/2023
Specifications
Citations
Citations
