BDS-II

DeltaKappa-actitoxin-Avd4b, Blood depressing substance II, Blood depressing substance 2
A Blocker of KV3 Channels and a Modulator of NaV Channels
    Cat #: B-450
    Alternative Name DeltaKappa-actitoxin-Avd4b, Blood depressing substance II, Blood depressing substance 2
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Natural peptide isolated from Anemonia sulcata (Mediterranean snakelocks sea anemone).
    MW: 4776 Da.
    Purity: >95% (HPLC)
    Effective concentration 100 nM - 5 µM.
    Sequence AAPCFCPGKPDRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH.
    Modifications Disulfide bonds between Cys4-Cys39, Cys6-Cys32, and Cys22-Cys40.
      • BDS-II
    Molecular formula C214H307N57O57S6.
    Activity BDS-II blocks the KV3.4 current. The blocking effect is rapid, direct and reversible1. BDS-II also modulates voltage-gated Nachannels (in-house data).
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
      • BDS-II
        BDS-II inhibits KV3.4 channels heterologously expressed in Xenopus oocytes.
        Left: Example traces before (red) and during (black) bath perfusion of 1 µM BDS-II (#B-450). Holding potential was -100 mV, test potential to 0 mV (100 ms) was delivered every 10 seconds. Recordings were made while perfusing ND 96 Buffer. Right: Time course for the experiment shown on the left. The vertical bar indicates the period of BDS-II perfusion.
        BDS-II
        Alomone Labs BDS-II inhibits NaV1.7 channels stably expressed in HEK 293 cells.
        A. Time course of BDS-II (#B-450) action on NaV1.7 currents. Current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 20 ms voltage step to -20 mV. 100 nM BDS-II was perfused as indicated by the bar (green) for 80 sec. B. Superimposed examples of NaV1.7 channel current in the absence (control) and presence of 100 nM BDS-II (taken from the experiment in A).
    References - Scientific background
    • 1. Diochot, S. et al. (1998) J. Biol. Chem273, 6744.
    • 2. Yeung, S.Y. et al. (2005) J. Neurosci25, 8735.
    • 3. Liu, P. et al. (2012) J. Neurophysiol. 107, 3155.
      • BDS-II is a 43 amino acid peptidyl toxin isolated from the sea anemone Anemonia sulcata venom. BDS-II was shown to be a specific KV3.4 blocker. BDS-II blocked 70% of the KV3.4 current in COS-transfected cells at a concentration of 2.8 µM. The blocking effect was rapid, direct and reversible1. Recently it was shown that BDS-II blocks other KV3 channels with similar potencies.2

        The closely related BDS-I was shown to modulate voltage-gated Nachannels. It enhanced TTX-sensitive Na+ channels (highly effective on NaV1.7 channels), and weakly inhibited TTX-resistant NaV channels3. As such, we showed that BDS-II also potently inhibits NaV1.7 channels (see Our Bioassay).

    Target KV3 K+ channels, NaV Na+ channels
    Net Peptide Content: 100%
    Last update: 04/11/2019

    BDS-II (#B-450) is a highly pure, natural, and biologically active peptide toxin.

    For research purposes only, not for human use