Calciseptine

CaS
A Specific Blocker of L-Type CaV Channels
Cat #: SPC-500
Alternative Name CaS
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide originated from Dendroaspis polylepis polylepis (Black mamba snake).
    MW: 7036 Da.
    Purity: >98%
    Form Lyophilized powder.
    Effective concentration 500 nM.
    Sequence RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK.
    Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58.
    Molecular formula C299H468N90O87S10.
    CAS No.: 178805-91-9.
    Activity Calciseptine is a specific antagonist of L-type CaV channels1.
    Shipping and storage Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs Calciseptine inhibits CaV1.2 channel current expressed in Xenopus oocytes.
        A. Representative time course of Calciseptine (#SPC-500) inhibition of CaV1.2 channel currents. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and significantly inhibited by application of 1 µM Calciseptine (green). B. Superimposed traces of CaV1.2 current after application of control (black) and of 1 µM Calciseptine (green), taken from the recording in A.
      • Calciseptine is a peptide toxin originally isolated from the Dendroaspis p. polylepsis black mamba venom1 shown to be a specific L-type CaV channel blocker2. However, in skeletal muscle, it increases L-type currents3.

        Calciseptine blocks spontaneous or K+-induced contraction of cardiac and smooth muscle cells2. Using patch clamp, it was also shown to block specifically L-type CaV channel current in neuronal cells in culture2 with IC50 values of 15-500 nM. Using the outside-out configuration of patch clamp, it was shown to reduce single L-type channels open probability and availability as recorded from the guinea pig portal vein4.

    Target L-type Ca2+ channels
    Net Peptide Content: 100%
    Last update: 04/07/2019

    Calciseptine (#SPC-500) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use