Overview
Cat #:
STH-400
Alternative Name K+ channel toxin α-KTx 2.5, HgTX1
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4220 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 0.1-0.2 pM.
Sequence TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH.
Modifications Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36.
Molecular formula C181H299N53O49S7.
CAS No.: 203526-59-4
Activity Hongotoxin-1 is a potent selective inhibitor of KV1.1, KV1.2 and KV1.3 voltage-gated K+ channels and a weak inhibitor of KV1.6 K+ channel. Hongotoxin does not block KV1.4 nor KV1.5 currents1.
References-Activity
- Koschak, A. et al. (1998) J. Biol. Chem. 273, 2639.
Accession number P59847.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Hongotoxin-1 blocks KV1.3 channels expressed in Xenopus oocytes.A. Representative time course of Hongotoxin-1 (#STH-400) inhibition of normalized KV1.3 current at +60mV. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and significantly inhibited by 1 nM Hongotoxin-1 (green). B. Superimposed traces of KV1.3 current after application of control (black) and of 1 nM Hongotoxin-1 (green), taken from the recording in A.
Scientific background
Hongotoxin is a peptide toxin originally isolated from the scorpion Centruroides limbatus1 and was shown to block cloned and heterologously expressed (in HEK 293 cells) KV1.1, KV1.2 and KV1.3 with IC50 of 31, 170 and 86 pM respectively1. In addition, it blocks KV1.6 with lower affinity (IC50 = 6 nM).
Hongotoxin-1 action was examined by monitoring radiolabeled Rb+ efflux from KV channels-transfected HEK 293 cells. Hongotoxin-1 blocks 125I-Margtoxin (Margatoxin) binding to rat brain synaptosomes1 or 125I-Kaliotoxin binding to purified KV1.3-KcsA chimeras2. A mutated 125I-Hongotoxin-1 was used to immunoprecipitate (with specific KV antibodies) rat brain KV channels and to determine their subunit composition1.
Target KV1.1, KV1.2, KV1.3 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 10/04/2023
Specifications
Citations
Citations