Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Blockers

Calciseptine

CaS
A Specific Blocker of L-Type CaV Channels
Cat #: SPC-500
Alternative Name CaS
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 7036 Da.
    Purity: >98%
    Form Lyophilized powder.
    Effective concentration 500 nM.
    Sequence RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK.
    Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58.
    Structure
    Molecular formula C299H468N90O87S10.
    CAS No.: 178805-91-9.
    Activity Calciseptine is a specific antagonist of L-type CaV channels1.
    References-Activity
    1. de Weille, J.R. et al. (1991) Proc. Natl. Acad. Sci. U.S.A. 88, 2437.
    Accession number P22947.
    Shipping and storage Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Calciseptine inhibits CaV1.2 channel current expressed in Xenopus oocytes.
      Alomone Labs Calciseptine inhibits CaV1.2 channel current expressed in Xenopus oocytes.
      A. Representative time course of Calciseptine (#SPC-500) inhibition of CaV1.2 channel currents. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and significantly inhibited by application of 1 µM Calciseptine (green). B. Superimposed traces of CaV1.2 current after application of control (black) and of 1 µM Calciseptine (green), taken from the recording in A.
    References - Scientific background
    1. Schweitz, H. et al. (1990) Toxicon 28, 847.
    2. de Weille, J.R. et al. (1991) Proc. Natl. Acad. Sci. U.S.A. 88, 2437.
    3. Garcia, M.C. et al. (2001) J. Membr. Biol. 184, 121.
    4. Teramoto, N. et al. (1996) Pflugers Arch. 432, 462.
    Scientific background

    Calciseptine is a peptide toxin originally isolated from the Dendroaspis p. polylepsis black mamba venom1 and shown to be a specific L-type CaV channel blocker2. However, in skeletal muscle, it increases L-type currents3.

    Calciseptine blocks spontaneous or K+-induced contraction of cardiac and smooth muscle cells2. Using a patch clamp, it was also shown to block specifically L-type CaV channel currents in neuronal cells in culture2 with IC50 values of 15-500 nM. Using the outside-out configuration of patch clamp, it was shown to reduce single L-type channel's open probability and availability as recorded from the guinea pig portal vein4.

    Target L-type Ca2+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    Last update: 23/08/2020

    Calciseptine (#SPC-500) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Chetrit, J. et al. (2013) J. Neurosci. 33, 14840.
    2. Heinke, B. et al. (2011) J. Neurosci. 31, 1313.
    3. José, O. et al. (2010) Biochem. Biophys. Res. Commun. 395, 530.
    4. Malinina, E. et al. (2010) J. Neurophysiol. 104, 200.

    Related Products

    Shipping and Ordering information

    Resources

    Modulation of Heart Function by Natural Neurotoxins

    Voltage-Gated Ca2+ Channels in the Cardiovascular System

    L-Type (CaV1) Channels

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us