Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Citations Search Tool
    • column
      • Blog
      • Articles
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Antibodies to KV Channels

Certificate of Analysis

Anti-KV1.3 (KCNA3) Antibody

Potassium voltage-gated channel subfamily A member 3

Cat #: APC-002
Alternative Name Potassium voltage-gated channel subfamily A member 3
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Accession (Uniprot) Number P22001
Gene ID 3738
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Rat, rabbit, mouse - identical.
RRID AB_2040151.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.6 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, ip, wb
May also work in: ifc*
Western blot
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-KV1.3 (KCNA3) Antibody (#APC-002), (1:200).
    2. Anti-KV1.3 (KCNA3) Antibody, preincubated with Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002).
  • Rat brain membranes (1:200). Human CD3+ cells (Szigligeti, P. et al. (2006) J. Physiol. 573, 357.).
Immunoprecipitation
  • Transfected HEK-293 cell lysate (Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675.).
Immunohistochemistry
  • Rat brain sections.
Immunocytochemistry
  • Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem. 99, 426.).
Scientific background

KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel, encoded by KCNA3, is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. The prominence of KV1.3 channels in these cells (particularly in T lymphocytes) directed much research attention. It was found that KV1.3 is the main channel responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.1,2 Based on the central role of KV1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.1

KV1.3 channels are potently inhibited by several venomous peptide toxins among them Charybdotoxin (2.6 nM), Noxiustoxin (1 nM), Kaliotoxin (0.65 nM), Margatoxin (0.05 nM), Agitoxin-1 (1.7 nM), Agitoxin-2 (0.004 nM), Hongotoxin-1 (0.09 nM)  and Stichodactyla toxin (0.01 nM).3-7

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Lyophilized Powder
Back to product pageSDSNew Generate a Quote
Last update: 08/01/2023

See Related Products

For research purposes only, not for human use

Specifications

Citations

Citations

Applications

Scientific Background

Shipping and Ordering information
    Back to product pageSDSNew Generate a Quote

    Control Product

    • Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002) is the original antigen used for immunization during Anti-KV1.3 (KCNA3) Antibody (#APC-002) generation. The blocking peptide binds and ‘blocks’ Anti-Kv1.3/KCNA3 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

      Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002)

    Resources

    • The Role of Ion Channels in Neurodegeneration
    • The Involvement of Ion Channels in Cell Proliferation
    • Kv1.3 channels

    Free International Shipping

    Products are lyophilized and ship at room temperature - FREE OF CHARGE.

    We ship worldwide within 24 hours of our next business day.

    For more country-specific shipping and contact information see Ordering & Shipping.


    Free Sample Program

    Not sure whether the product fits your experimental setup?

    Try it first!


    Alomone Guarantee

    We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

    Alomone Guarantee information

    Resources

    • The Role of Ion Channels in Neurodegeneration

    • The Involvement of Ion Channels in Cell Proliferation

    • Kv1.3 channels

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us

    Contact Us

    © 2023 Alomone Labs. All Rights Reserved.

    Terms of Service Privacy Policy
    Scroll to top

    Bulk / Customized order